Cart 0 Product Products (empty)
No products
To be determined Shipping
0,00 € Total
Prices are tax excluded
Product successfully added to your shopping cart
Quantity
Total
There are 0 items in your cart. There is 1 item in your cart.
Total products (tax excl.)
Total shipping (tax excl.) To be determined
Total (tax excl.)
Data sheet of PPP2R5C monoclonal antibody (M01), clone 3G9
| Brand | Abnova |
| Product type | Primary antibodies |
| Reactivity | Human |
| Host species | Mouse |
| Applications | S-ELISA,ELISA,WB-Tr,PLA-Ce |
More info about PPP2R5C monoclonal antibody (M01), clone 3G9
| Brand: | Abnova |
| Reference: | H00005527-M01 |
| Product name: | PPP2R5C monoclonal antibody (M01), clone 3G9 |
| Product description: | Mouse monoclonal antibody raised against a partial recombinant PPP2R5C. |
| Clone: | 3G9 |
| Isotype: | IgG2a Kappa |
| Gene id: | 5527 |
| Gene name: | PPP2R5C |
| Gene alias: | B56G|MGC23064|PR61G |
| Gene description: | protein phosphatase 2, regulatory subunit B', gamma isoform |
| Genbank accession: | NM_002719 |
| Immunogen: | PPP2R5C (NP_002710.2, 1 a.a. ~ 100 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. |
| Immunogen sequence/protein sequence: | MLTCNKAGSRMVVDAANSNGPFQPVVLLHIRDVPPADQEKLFIQKLRQCCVLFDFVSDPLSDLKWKEVKRAALSEMVEYITHNRNVITEPIYPEVVHMFA |
| Protein accession: | NP_002710.2 |
| Storage buffer: | In 1x PBS, pH 7.4 |
| Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
| Quality control testing: | Antibody Reactive Against Recombinant Protein. |
| Product type: | Primary antibodies |
| Host species: | Mouse |
| Antigen species / target species: | Human |
| Reactivity: | Human |
| Application image: |  |
| Application image note: | Detection limit for recombinant GST tagged PPP2R5C is approximately 3ng/ml as a capture antibody. |
| Applications: | S-ELISA,ELISA,WB-Tr,PLA-Ce |
| Shipping condition: | Dry Ice |