Cart 0 Product Products (empty)
No products
To be determined Shipping
0,00 € Total
Prices are tax excluded
Product successfully added to your shopping cart
Quantity
Total
There are 0 items in your cart. There is 1 item in your cart.
Total products (tax excl.)
Total shipping (tax excl.) To be determined
Total (tax excl.)
Data sheet of PPP2R2B monoclonal antibody (M01), clone 2C11
| Brand | Abnova |
| Product type | Primary antibodies |
| Reactivity | Human |
| Host species | Mouse |
| Applications | S-ELISA,ELISA,WB-Re |
More info about PPP2R2B monoclonal antibody (M01), clone 2C11
| Brand: | Abnova |
| Reference: | H00005521-M01 |
| Product name: | PPP2R2B monoclonal antibody (M01), clone 2C11 |
| Product description: | Mouse monoclonal antibody raised against a partial recombinant PPP2R2B. |
| Clone: | 2C11 |
| Isotype: | IgG2a Kappa |
| Gene id: | 5521 |
| Gene name: | PPP2R2B |
| Gene alias: | B55-BETA|FLJ95686|MGC24888|PP2A-B55BETA|PP2A-PR55B|PP2AB-BETA|PP2APR55-BETA|PR2AB-BETA|PR2AB55-BETA|PR2APR55-BETA|PR52B|PR55-BETA|SCA12 |
| Gene description: | protein phosphatase 2 (formerly 2A), regulatory subunit B, beta isoform |
| Genbank accession: | BC031790 |
| Immunogen: | PPP2R2B (AAH31790, 101 a.a. ~ 200 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. |
| Immunogen sequence/protein sequence: | QNAAYFLLSTNDKTVKLWKVSERDKRPEGYNLKDEEGRLRDPATITTLRVPVLRPMDLMVEATPRRVFANAHTYHINSISVNSDYETYMSADDLRINLWN |
| Protein accession: | AAH31790 |
| Storage buffer: | In 1x PBS, pH 7.4 |
| Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
| Quality control testing: | Antibody Reactive Against Recombinant Protein. |
| Quality control testing picture: |  |
| Quality control testing picture note: | Western Blot detection against Immunogen (36.63 KDa) . |
| Product type: | Primary antibodies |
| Host species: | Mouse |
| Antigen species / target species: | Human |
| Reactivity: | Human |
| Application image: | http://www.abnova.com/application_image/ |
| Application image note: | Detection limit for recombinant GST tagged PPP2R2B is approximately 3ng/ml as a capture antibody. |
| Applications: | S-ELISA,ELISA,WB-Re |
| Shipping condition: | Dry Ice |
| Publications: | Ataxia telangiectasia mutated nuclear localization in head and neck cancer cells is PPP2R2B-dependent.Suyarnsestakorn C, Thanasupawat T, Leelahavanichkul K, Gutkind JS, Mutirangura A. Asian Biomedicine Vol. 4 No. 3 June 2010; 373-383 |