PPP1R8 monoclonal antibody (M05), clone 4B5 View larger

PPP1R8 monoclonal antibody (M05), clone 4B5

H00005511-M05_100ug

New product

395,00 € tax excl.

100 ug

Customer ratings and reviews

Nobody has posted a review yet
in this language

Data sheet of PPP1R8 monoclonal antibody (M05), clone 4B5

BrandAbnova
Product typePrimary antibodies
ReactivityHuman
Host speciesMouse
ApplicationsS-ELISA,ELISA,WB-Re,WB-Tr,IP

More info about PPP1R8 monoclonal antibody (M05), clone 4B5

Brand: Abnova
Reference: H00005511-M05
Product name: PPP1R8 monoclonal antibody (M05), clone 4B5
Product description: Mouse monoclonal antibody raised against a partial recombinant PPP1R8.
Clone: 4B5
Isotype: IgG2a Kappa
Gene id: 5511
Gene name: PPP1R8
Gene alias: ARD-1|ARD1|NIPP-1|NIPP1|PRO2047
Gene description: protein phosphatase 1, regulatory (inhibitor) subunit 8
Genbank accession: NM_002713
Immunogen: PPP1R8 (NP_002704.1, 28 a.a. ~ 127 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Immunogen sequence/protein sequence: RRMQNFAFSGGLYGGLPPTHSEAGSQPHGIHGTALIGGLPMPYPNLAPDVDLTPVVPSAVNMNPAPNPAVYNPEAVNEPKKKKYAKEAWPGKKPTPSLLI
Protein accession: NP_002704.1
Storage buffer: In 1x PBS, pH 7.4
Storage instruction: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Quality control testing: Antibody Reactive Against Recombinant Protein.
Quality control testing picture: qc_test-H00005511-M05-1.jpg
Quality control testing picture note: Western Blot detection against Immunogen (36.74 KDa) .
Product type: Primary antibodies
Host species: Mouse
Antigen species / target species: Human
Reactivity: Human
Application image: H00005511-M05-9-18-1.jpg
Application image note: Detection limit for recombinant GST tagged PPP1R8 is approximately 3ng/ml as a capture antibody.
Applications: S-ELISA,ELISA,WB-Re,WB-Tr,IP
Shipping condition: Dry Ice

Reviews

Buy PPP1R8 monoclonal antibody (M05), clone 4B5 now

Add to cart