Brand: | Abnova |
Reference: | H00005504-M01 |
Product name: | PPP1R2 monoclonal antibody (M01), clone 2E9 |
Product description: | Mouse monoclonal antibody raised against a partial recombinant PPP1R2. |
Clone: | 2E9 |
Isotype: | IgG2a Kappa |
Gene id: | 5504 |
Gene name: | PPP1R2 |
Gene alias: | IPP2|MGC87148 |
Gene description: | protein phosphatase 1, regulatory (inhibitor) subunit 2 |
Genbank accession: | NM_006241 |
Immunogen: | PPP1R2 (NP_006232, 1 a.a. ~ 100 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. |
Immunogen sequence/protein sequence: | MAASTASHRPIKGILKNKTSTTSSMVASAEQPRGNVDEELSKKSQKWDEMNILATYHPADKDYGLMKIDEPSTPYHSMMGDDEDACSDTEATEAMAPDIL |
Protein accession: | NP_006232 |
Storage buffer: | In 1x PBS, pH 7.4 |
Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
Quality control testing: | Antibody Reactive Against Recombinant Protein. |
Quality control testing picture: |  |
Quality control testing picture note: | Western Blot detection against Immunogen (36.74 KDa) . |
Product type: | Primary antibodies |
Host species: | Mouse |
Antigen species / target species: | Human |
Reactivity: | Human |
Application image: |  |
Application image note: | Immunoperoxidase of monoclonal antibody to PPP1R2 on formalin-fixed paraffin-embedded human placenta. [antibody concentration 3 ug/ml] |
Applications: | IHC-P,S-ELISA,ELISA,WB-Re |
Shipping condition: | Dry Ice |