Cart 0 Product Products (empty)
No products
To be determined Shipping
0,00 € Total
Prices are tax excluded
Product successfully added to your shopping cart
Quantity
Total
There are 0 items in your cart. There is 1 item in your cart.
Total products (tax excl.)
Total shipping (tax excl.) To be determined
Total (tax excl.)
Data sheet of PPM1B monoclonal antibody (M01), clone 1A3-2A4
| Brand | Abnova |
| Product type | Primary antibodies |
| Reactivity | Human |
| Host species | Mouse |
| Applications | IF,S-ELISA,ELISA,WB-Re,WB-Tr,IP,RNAi-Ab,PLA-Ce |
More info about PPM1B monoclonal antibody (M01), clone 1A3-2A4
| Brand: | Abnova |
| Reference: | H00005495-M01 |
| Product name: | PPM1B monoclonal antibody (M01), clone 1A3-2A4 |
| Product description: | Mouse monoclonal antibody raised against a full length recombinant PPM1B. |
| Clone: | 1A3-2A4 |
| Isotype: | IgG1 kappa |
| Gene id: | 5495 |
| Gene name: | PPM1B |
| Gene alias: | MGC21657|PP2C-beta-X|PP2CB|PP2CBETA|PPC2BETAX |
| Gene description: | protein phosphatase 1B (formerly 2C), magnesium-dependent, beta isoform |
| Genbank accession: | BC012002 |
| Immunogen: | PPM1B (AAH12002, 1 a.a. ~ 192 a.a) full-length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. |
| Immunogen sequence/protein sequence: | MSIVLVCFSNAPKVSDEAVKKDSELDKHLESRVEEIMEKSGEEGMPDLAHVMRILSAENIPNLPPGGGLAGKRNVIEAVYSRLNPHRESDGASDEAEESGSQGKLVEALRQMRINHRGNYRQLLEEMLTSYRLAKVEGEESPAEPAATATSSNSDAGNPVTMQESHTESESGLAELDSSNEDAGTKMSGEKI |
| Protein accession: | AAH12002 |
| Storage buffer: | In 1x PBS, pH 7.4 |
| Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
| Quality control testing: | Antibody Reactive Against Recombinant Protein. |
| Quality control testing picture: |  |
| Quality control testing picture note: | Western Blot detection against Immunogen (46.86 KDa) . |
| Product type: | Primary antibodies |
| Host species: | Mouse |
| Antigen species / target species: | Human |
| Reactivity: | Human |
| Application image: |  |
| Application image note: | Western Blot analysis of PPM1B expression in transfected 293T cell line by PPM1B monoclonal antibody (M01), clone 1A3-2A4. Lane 1: PPM1B transfected lysate(52.643 KDa). Lane 2: Non-transfected lysate. |
| Applications: | IF,S-ELISA,ELISA,WB-Re,WB-Tr,IP,RNAi-Ab,PLA-Ce |
| Shipping condition: | Dry Ice |