Brand: | Abnova |
Reference: | H00005480-M03 |
Product name: | PPIC monoclonal antibody (M03), clone 1A10 |
Product description: | Mouse monoclonal antibody raised against a full-length recombinant PPIC. |
Clone: | 1A10 |
Isotype: | IgG2a Kappa |
Gene id: | 5480 |
Gene name: | PPIC |
Gene alias: | CYPC|MGC3673 |
Gene description: | peptidylprolyl isomerase C (cyclophilin C) |
Genbank accession: | BC002678.2 |
Immunogen: | PPIC (AAH02678.1, 1 a.a. ~ 124 a.a) full-length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. |
Immunogen sequence/protein sequence: | MGPGPRLLLPLVLCVGLGALVFSSGAEGFRKRGPSVTAKVFFDVRIGDKDVGRIVIGLFGKVVPKTVENFVALATGEKGYGYKGSKFHRVIKDFMIQGGDITTGDGTGGVSIYGETFPDENFKL |
Protein accession: | AAH02678.1 |
Storage buffer: | In 1x PBS, pH 7.4 |
Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
Quality control testing: | Antibody Reactive Against Recombinant Protein. |
Product type: | Primary antibodies |
Host species: | Mouse |
Antigen species / target species: | Human |
Reactivity: | Human |
Application image: |  |
Application image note: | Detection limit for recombinant GST tagged PPIC is 1 ng/ml as a capture antibody. |
Applications: | S-ELISA,ELISA |
Shipping condition: | Dry Ice |