Brand: | Abnova |
Reference: | H00005478-M01 |
Product name: | PPIA monoclonal antibody (M01), clone 1F4-1B5 |
Product description: | Mouse monoclonal antibody raised against a full length recombinant PPIA. |
Clone: | 1F4-1B5 |
Isotype: | IgG2a kappa |
Gene id: | 5478 |
Gene name: | PPIA |
Gene alias: | CYPA|CYPH|MGC117158|MGC12404|MGC23397 |
Gene description: | peptidylprolyl isomerase A (cyclophilin A) |
Genbank accession: | BC000689 |
Immunogen: | PPIA (AAH00689.1, 1 a.a. ~ 165 a.a) full-length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. |
Immunogen sequence/protein sequence: | MVNPTVFFDIAVDGEPLGRVSFELFADKVPKTAENFRALSTGEKGFGYKGSCFHRIIPGFMCQGGDFTRHNGTGGKSIYGEKFEDENFILKHTGPGILSMANAGPNTNGSQFFICTAKTEWLDGKHVVFGKVKEGMNIVEAMERFGSRNGKTSKKITIADCGQLE |
Protein accession: | AAH00689.1 |
Storage buffer: | In 1x PBS, pH 7.4 |
Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
Quality control testing: | Antibody Reactive Against Recombinant Protein. |
Quality control testing picture: | ![qc_test-H00005478-M01-1.jpg](http://www.abnova.com/qc_test_image/qc_test-H00005478-M01-1.jpg) |
Quality control testing picture note: | Western Blot detection against Immunogen (43.89 KDa) . |
Product type: | Primary antibodies |
Host species: | Mouse |
Antigen species / target species: | Human |
Reactivity: | Human |
Application image: | ![H00005478-M01-1-6-1.jpg](http://www.abnova.com/application_image/H00005478-M01-1-6-1.jpg) |
Application image note: | PPIA monoclonal antibody (M01), clone 1F4-1B5 Western Blot analysis of PPIA expression in Jurkat ( Cat # L017V1 ). |
Applications: | WB-Ce,S-ELISA,ELISA,WB-Re,WB-Tr |
Shipping condition: | Dry Ice |
Publications: | Tissue proteomics reveals differential and compartment-specific expression of the homologs transgelin and transgelin-2 in lung adenocarcinoma and its stroma.Rho JH, Roehrl MH, Wang JY. J Proteome Res. 2009 Dec;8(12):5610-8. |