Brand: | Abnova |
Reference: | H00005469-M05 |
Product name: | PPARBP monoclonal antibody (M05), clone 2H6 |
Product description: | Mouse monoclonal antibody raised against a partial recombinant PPARBP. |
Clone: | 2H6 |
Isotype: | IgG1 Kappa |
Gene id: | 5469 |
Gene name: | MED1 |
Gene alias: | CRSP1|CRSP200|DRIP205|DRIP230|MGC71488|PBP|PPARBP|PPARGBP|RB18A|TRAP220|TRIP2 |
Gene description: | mediator complex subunit 1 |
Genbank accession: | NM_004774 |
Immunogen: | PPARBP (NP_004765, 1391 a.a. ~ 1490 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. |
Immunogen sequence/protein sequence: | KIIISKHDGGSPSIKAKVTLQKPGESSGEGLRPQMASSKNYGSPLISGSTPKHERGSPSHSKSPAYTPQNLDSESESGSSIAEKSYQNSPSSDDGIRPLP |
Protein accession: | NP_004765 |
Storage buffer: | In 1x PBS, pH 7.4 |
Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
Quality control testing: | Antibody Reactive Against Recombinant Protein. |
Quality control testing picture: |  |
Quality control testing picture note: | Western Blot detection against Immunogen (36.74 KDa) . |
Product type: | Primary antibodies |
Host species: | Mouse |
Antigen species / target species: | Human |
Reactivity: | Human |
Application image: |  |
Application image note: | Detection limit for recombinant GST tagged PPARBP is approximately 0.3ng/ml as a capture antibody. |
Applications: | S-ELISA,ELISA,WB-Re |
Shipping condition: | Dry Ice |