PPARBP monoclonal antibody (M03), clone 1G4 View larger

PPARBP monoclonal antibody (M03), clone 1G4

New product

395,00 € tax excl.

Customer ratings and reviews

Nobody has posted a review yet
in this language

Data sheet of PPARBP monoclonal antibody (M03), clone 1G4

BrandAbnova
Product typePrimary antibodies
ReactivityHuman
Host speciesMouse
ApplicationsS-ELISA,ELISA,WB-Re

More info about PPARBP monoclonal antibody (M03), clone 1G4

Brand: Abnova
Reference: H00005469-M03
Product name: PPARBP monoclonal antibody (M03), clone 1G4
Product description: Mouse monoclonal antibody raised against a partial recombinant PPARBP.
Clone: 1G4
Isotype: IgG1 Kappa
Gene id: 5469
Gene name: MED1
Gene alias: CRSP1|CRSP200|DRIP205|DRIP230|MGC71488|PBP|PPARBP|PPARGBP|RB18A|TRAP220|TRIP2
Gene description: mediator complex subunit 1
Genbank accession: NM_004774
Immunogen: PPARBP (NP_004765, 1391 a.a. ~ 1490 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Immunogen sequence/protein sequence: KIIISKHDGGSPSIKAKVTLQKPGESSGEGLRPQMASSKNYGSPLISGSTPKHERGSPSHSKSPAYTPQNLDSESESGSSIAEKSYQNSPSSDDGIRPLP
Protein accession: NP_004765
Storage buffer: In 1x PBS, pH 7.4
Storage instruction: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Quality control testing: Antibody Reactive Against Recombinant Protein.
Quality control testing picture: qc_test-H00005469-M03-1.jpg
Quality control testing picture note: Western Blot detection against Immunogen (36.74 KDa) .
Product type: Primary antibodies
Host species: Mouse
Antigen species / target species: Human
Reactivity: Human
Application image: H00005469-M03-9-21-1.jpg
Application image note: Detection limit for recombinant GST tagged PPARBP is approximately 0.1ng/ml as a capture antibody.
Applications: S-ELISA,ELISA,WB-Re
Shipping condition: Dry Ice

Reviews

Buy PPARBP monoclonal antibody (M03), clone 1G4 now

Add to cart