Brand: | Abnova |
Reference: | H00005467-M03 |
Product name: | PPARD monoclonal antibody (M03), clone 1G4 |
Product description: | Mouse monoclonal antibody raised against a partial recombinant PPARD. |
Clone: | 1G4 |
Isotype: | IgG1 Kappa |
Gene id: | 5467 |
Gene name: | PPARD |
Gene alias: | FAAR|MGC3931|NR1C2|NUC1|NUCI|NUCII|PPAR-beta|PPARB |
Gene description: | peroxisome proliferator-activated receptor delta |
Genbank accession: | NM_006238 |
Immunogen: | PPARD (NP_006229, 56 a.a. ~ 165 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. |
Immunogen sequence/protein sequence: | DQLQMGCDGASCGSLNMECRVCGDKASGFHYGVHACEGCKGFFRRTIRMKLEYEKCERSCKIQKKNRNKCQYCRFQKCLALGMSHNAIRFGRMPEAEKRKLVAGLTANEG |
Protein accession: | NP_006229 |
Storage buffer: | In 1x PBS, pH 7.4 |
Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
Quality control testing: | Antibody Reactive Against Recombinant Protein. |
Quality control testing picture: | ![qc_test-H00005467-M03-1.jpg](http://www.abnova.com/qc_test_image/qc_test-H00005467-M03-1.jpg) |
Quality control testing picture note: | Western Blot detection against Immunogen (37.84 KDa) . |
Product type: | Primary antibodies |
Host species: | Mouse |
Antigen species / target species: | Human |
Reactivity: | Human |
Application image: | ![H00005467-M03-1-9-1.jpg](http://www.abnova.com/application_image/H00005467-M03-1-9-1.jpg) |
Application image note: | PPARD monoclonal antibody (M03), clone 1G4 Western Blot analysis of PPARD expression in K-562 ( Cat # L009V1 ). |
Applications: | WB-Ce,S-ELISA,ELISA,WB-Re |
Shipping condition: | Dry Ice |