Brand: | Abnova |
Reference: | H00005463-M03 |
Product name: | POU6F1 monoclonal antibody (M03), clone 6F10 |
Product description: | Mouse monoclonal antibody raised against a partial recombinant POU6F1. |
Clone: | 6F10 |
Isotype: | IgG2a Kappa |
Gene id: | 5463 |
Gene name: | POU6F1 |
Gene alias: | BRN5|MPOU|TCFB1 |
Gene description: | POU class 6 homeobox 1 |
Genbank accession: | NM_002702 |
Immunogen: | POU6F1 (NP_002693, 193 a.a. ~ 301 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. |
Immunogen sequence/protein sequence: | ITPKSAQKLKPVLEKWLNEAELRNQEGQQNLMEFVGGEPSKKRKRRTSFTPQAIEALNAYFEKNPLPTGQEITEIAKELNYDREVVRVWFCNRRQTLKNTSKLNVFQIP |
Protein accession: | NP_002693 |
Storage buffer: | In 1x PBS, pH 7.4 |
Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
Quality control testing: | Antibody Reactive Against Recombinant Protein. |
Quality control testing picture: |  |
Quality control testing picture note: | Western Blot detection against Immunogen (37.73 KDa) . |
Product type: | Primary antibodies |
Host species: | Mouse |
Antigen species / target species: | Human |
Reactivity: | Human |
Application image: |  |
Application image note: | POU6F1 monoclonal antibody (M03), clone 6F10 Western Blot analysis of POU6F1 expression in Jurkat ( Cat # L017V1 ). |
Applications: | WB-Ce,S-ELISA,ELISA,WB-Re |
Shipping condition: | Dry Ice |