POU6F1 monoclonal antibody (M02), clone 5F9 View larger

POU6F1 monoclonal antibody (M02), clone 5F9

H00005463-M02_100ug

New product

395,00 € tax excl.

100 ug

Customer ratings and reviews

Nobody has posted a review yet
in this language

Data sheet of POU6F1 monoclonal antibody (M02), clone 5F9

BrandAbnova
Product typePrimary antibodies
ReactivityHuman
Host speciesMouse
ApplicationsWB-Ce,S-ELISA,ELISA,WB-Re

More info about POU6F1 monoclonal antibody (M02), clone 5F9

Brand: Abnova
Reference: H00005463-M02
Product name: POU6F1 monoclonal antibody (M02), clone 5F9
Product description: Mouse monoclonal antibody raised against a partial recombinant POU6F1.
Clone: 5F9
Isotype: IgG2a Kappa
Gene id: 5463
Gene name: POU6F1
Gene alias: BRN5|MPOU|TCFB1
Gene description: POU class 6 homeobox 1
Genbank accession: NM_002702
Immunogen: POU6F1 (NP_002693, 193 a.a. ~ 301 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Immunogen sequence/protein sequence: ITPKSAQKLKPVLEKWLNEAELRNQEGQQNLMEFVGGEPSKKRKRRTSFTPQAIEALNAYFEKNPLPTGQEITEIAKELNYDREVVRVWFCNRRQTLKNTSKLNVFQIP
Protein accession: NP_002693
Storage buffer: In 1x PBS, pH 7.4
Storage instruction: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Quality control testing: Antibody Reactive Against Recombinant Protein.
Quality control testing picture: qc_test-H00005463-M02-1.jpg
Quality control testing picture note: Western Blot detection against Immunogen (37.73 KDa) .
Product type: Primary antibodies
Host species: Mouse
Antigen species / target species: Human
Reactivity: Human
Application image: H00005463-M02-1-6-1.jpg
Application image note: POU6F1 monoclonal antibody (M02), clone 5F9 Western Blot analysis of POU6F1 expression in Jurkat ( Cat # L017V1 ).
Applications: WB-Ce,S-ELISA,ELISA,WB-Re
Shipping condition: Dry Ice

Reviews

Buy POU6F1 monoclonal antibody (M02), clone 5F9 now

Add to cart