POU6F1 purified MaxPab mouse polyclonal antibody (B01P) View larger

POU6F1 purified MaxPab mouse polyclonal antibody (B01P)

New product

395,00 € tax excl.

Customer ratings and reviews

Nobody has posted a review yet
in this language

Data sheet of POU6F1 purified MaxPab mouse polyclonal antibody (B01P)

BrandAbnova
Product typePrimary antibodies
ReactivityHuman
Host speciesMouse
ApplicationsWB-Tr

More info about POU6F1 purified MaxPab mouse polyclonal antibody (B01P)

Brand: Abnova
Reference: H00005463-B01P
Product name: POU6F1 purified MaxPab mouse polyclonal antibody (B01P)
Product description: Mouse polyclonal antibody raised against a full-length human POU6F1 protein.
Gene id: 5463
Gene name: POU6F1
Gene alias: BRN5|MPOU|TCFB1
Gene description: POU class 6 homeobox 1
Genbank accession: BC074765.2
Immunogen: POU6F1 (AAH74765.3, 1 a.a. ~ 301 a.a) full-length human protein.
Immunogen sequence/protein sequence: MPGISSQILTNAQGQVIGTLPWVVNSASVAAPAPAQSLQVQAVTPQLLLNAQGQVIATLASSPLPPPVAVRKPSTPESPAKSEVQPIQPTPTVPQPAVVIASPAPAAKPSASAPIPITCSETPTVSQLVSKPHTPSLDEDGINLEEIREFAKNFKIRRLSLGLTQTQVGQALTATEGPAYSQSAICRFEKLDITPKSAQKLKPVLEKWLNEAELRNQEGQQNLMEFVGGEPSKKRKRRTSFTPQAIEALNAYFEKNPLPTGQEITEIAKELNYDREVVRVWFCNRRQTLKNTSKLNVFQIP
Protein accession: AAH74765.3
Storage buffer: In 1x PBS, pH 7.4
Storage instruction: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Quality control testing: Antibody reactive against mammalian transfected lysate.
Product type: Primary antibodies
Host species: Mouse
Antigen species / target species: Human
Reactivity: Human
Application image: H00005463-B01P-13-15-1.jpg
Application image note: Western Blot analysis of POU6F1 expression in transfected 293T cell line (H00005463-T01) by POU6F1 MaxPab polyclonal antibody.

Lane 1: POU6F1 transfected lysate(33.11 KDa).
Lane 2: Non-transfected lysate.
Applications: WB-Tr
Shipping condition: Dry Ice

Reviews

Buy POU6F1 purified MaxPab mouse polyclonal antibody (B01P) now

Add to cart