Brand: | Abnova |
Reference: | H00005460-M05 |
Product name: | POU5F1 monoclonal antibody (M05), clone 1B11 |
Product description: | Mouse monoclonal antibody raised against a full length recombinant POU5F1. |
Clone: | 1B11 |
Isotype: | IgG2a Kappa |
Gene id: | 5460 |
Gene name: | POU5F1 |
Gene alias: | MGC22487|OCT3|OCT4|OTF3|OTF4 |
Gene description: | POU class 5 homeobox 1 |
Genbank accession: | BC020712 |
Immunogen: | POU5F1 (AAH20712, 81 a.a. ~ 164 a.a) full length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. |
Immunogen sequence/protein sequence: | WFCNRRQKGKRSSSDYAQREDFEAAGSPFSGGPVSFPLAPGPHFGTPGYGSPHFTALYSSVPFPEGEAFPPVSVTTLGSPMHSN |
Protein accession: | AAH20712 |
Storage buffer: | In 1x PBS, pH 7.4 |
Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
Quality control testing: | Antibody Reactive Against Recombinant Protein. |
Quality control testing picture: | ![qc_test-H00005460-M05-1.jpg](http://www.abnova.com/qc_test_image/qc_test-H00005460-M05-1.jpg) |
Quality control testing picture note: | Western Blot detection against Immunogen (35.24 KDa) . |
Product type: | Primary antibodies |
Host species: | Mouse |
Antigen species / target species: | Human |
Reactivity: | Human |
Application image: | ![H00005460-M05-1-12-1.jpg](http://www.abnova.com/application_image/H00005460-M05-1-12-1.jpg) |
Application image note: | POU5F1 monoclonal antibody (M05), clone 1B11 Western Blot analysis of POU5F1 expression in HepG2 ( Cat # L019V1 ). |
Applications: | WB-Ce,IF,ELISA,WB-Re,WB-Tr,IF-CTC |
Shipping condition: | Dry Ice |
Publications: | Physiologic Oxygen Concentration Enhances the Stem-Like Properties of CD133+ Human Glioblastoma Cells In vitro.McCord AM, Jamal M, Shankavarum UT, Lang FF, Camphausen K, Tofilon PJ. Mol Cancer Res. 2009 Apr;7(4):489-97. |