POU5F1 monoclonal antibody (M02), clone 4F8 View larger

POU5F1 monoclonal antibody (M02), clone 4F8

H00005460-M02_100ug

New product

395,00 € tax excl.

100 ug

Customer ratings and reviews

Nobody has posted a review yet
in this language

Data sheet of POU5F1 monoclonal antibody (M02), clone 4F8

BrandAbnova
Product typePrimary antibodies
ReactivityHuman
Host speciesMouse
ApplicationsWB-Ce,ELISA,WB-Re,WB-Tr

More info about POU5F1 monoclonal antibody (M02), clone 4F8

Brand: Abnova
Reference: H00005460-M02
Product name: POU5F1 monoclonal antibody (M02), clone 4F8
Product description: Mouse monoclonal antibody raised against a full length recombinant POU5F1.
Clone: 4F8
Isotype: IgG2a Kappa
Gene id: 5460
Gene name: POU5F1
Gene alias: MGC22487|OCT3|OCT4|OTF3|OTF4
Gene description: POU class 5 homeobox 1
Genbank accession: BC020712
Immunogen: POU5F1 (AAH20712, 81 a.a. ~ 164 a.a) full length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Immunogen sequence/protein sequence: WFCNRRQKGKRSSSDYAQREDFEAAGSPFSGGPVSFPLAPGPHFGTPGYGSPHFTALYSSVPFPEGEAFPPVSVTTLGSPMHSN
Protein accession: AAH20712
Storage buffer: In 1x PBS, pH 7.4
Storage instruction: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Quality control testing: Antibody Reactive Against Recombinant Protein.
Quality control testing picture: qc_test-H00005460-M02-1.jpg
Quality control testing picture note: Western Blot detection against Immunogen (35.24 KDa) .
Product type: Primary antibodies
Host species: Mouse
Antigen species / target species: Human
Reactivity: Human
Application image: H00005460-M02-1-1-1.jpg
Application image note: POU5F1 monoclonal antibody (M02), clone 4F8 Western Blot analysis of POU5F1 expression in HeLa ( Cat # L013V1 ).
Applications: WB-Ce,ELISA,WB-Re,WB-Tr
Shipping condition: Dry Ice

Reviews

Buy POU5F1 monoclonal antibody (M02), clone 4F8 now

Add to cart