H00005460-M01_100ug
New product
Availability date:
Brand | Abnova |
Product type | Primary antibodies |
Reactivity | Human |
Host species | Mouse |
Applications | WB-Ce,ELISA,WB-Re,WB-Tr |
Brand: | Abnova |
Reference: | H00005460-M01 |
Product name: | POU5F1 monoclonal antibody (M01), clone 1D2 |
Product description: | Mouse monoclonal antibody raised against a partial recombinant POU5F1. |
Clone: | 1D2 |
Isotype: | IgG2b Kappa |
Gene id: | 5460 |
Gene name: | POU5F1 |
Gene alias: | MGC22487|OCT3|OCT4|OTF3|OTF4 |
Gene description: | POU class 5 homeobox 1 |
Genbank accession: | BC020712 |
Immunogen: | POU5F1 (AAH20712, 81 a.a. ~ 164 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. |
Immunogen sequence/protein sequence: | WFCNRRQKGKRSSSDYAQREDFEAAGSPFSGGPVSFPLAPGPHFGTPGYGSPHFTALYSSVPFPEGEAFPPVSVTTLGSPMHSN |
Protein accession: | AAH20712 |
Storage buffer: | In 1x PBS, pH 7.4 |
Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
Quality control testing: | Antibody Reactive Against Recombinant Protein. |
Quality control testing picture: | ![]() |
Quality control testing picture note: | Western Blot detection against Immunogen (35.24 KDa) . |
Product type: | Primary antibodies |
Host species: | Mouse |
Antigen species / target species: | Human |
Reactivity: | Human |
Application image: | ![]() |
Application image note: | Western Blot analysis of POU5F1 expression in transfected 293T cell line by POU5F1 monoclonal antibody (M01), clone 1D2. Lane 1: POU5F1 transfected lysate(18.3 KDa). Lane 2: Non-transfected lysate. |
Applications: | WB-Ce,ELISA,WB-Re,WB-Tr |
Shipping condition: | Dry Ice |