POU5F1 monoclonal antibody (M01), clone 1D2 View larger

POU5F1 monoclonal antibody (M01), clone 1D2

H00005460-M01_100ug

New product

395,00 € tax excl.

100 ug

Customer ratings and reviews

Nobody has posted a review yet
in this language

Data sheet of POU5F1 monoclonal antibody (M01), clone 1D2

BrandAbnova
Product typePrimary antibodies
ReactivityHuman
Host speciesMouse
ApplicationsWB-Ce,ELISA,WB-Re,WB-Tr

More info about POU5F1 monoclonal antibody (M01), clone 1D2

Brand: Abnova
Reference: H00005460-M01
Product name: POU5F1 monoclonal antibody (M01), clone 1D2
Product description: Mouse monoclonal antibody raised against a partial recombinant POU5F1.
Clone: 1D2
Isotype: IgG2b Kappa
Gene id: 5460
Gene name: POU5F1
Gene alias: MGC22487|OCT3|OCT4|OTF3|OTF4
Gene description: POU class 5 homeobox 1
Genbank accession: BC020712
Immunogen: POU5F1 (AAH20712, 81 a.a. ~ 164 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Immunogen sequence/protein sequence: WFCNRRQKGKRSSSDYAQREDFEAAGSPFSGGPVSFPLAPGPHFGTPGYGSPHFTALYSSVPFPEGEAFPPVSVTTLGSPMHSN
Protein accession: AAH20712
Storage buffer: In 1x PBS, pH 7.4
Storage instruction: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Quality control testing: Antibody Reactive Against Recombinant Protein.
Quality control testing picture: qc_test-H00005460-M01-1.jpg
Quality control testing picture note: Western Blot detection against Immunogen (35.24 KDa) .
Product type: Primary antibodies
Host species: Mouse
Antigen species / target species: Human
Reactivity: Human
Application image: H00005460-M01-13-15-1.jpg
Application image note: Western Blot analysis of POU5F1 expression in transfected 293T cell line by POU5F1 monoclonal antibody (M01), clone 1D2.

Lane 1: POU5F1 transfected lysate(18.3 KDa).
Lane 2: Non-transfected lysate.
Applications: WB-Ce,ELISA,WB-Re,WB-Tr
Shipping condition: Dry Ice

Reviews

Buy POU5F1 monoclonal antibody (M01), clone 1D2 now

Add to cart