Brand: | Abnova |
Reference: | H00005459-M01 |
Product name: | POU4F3 monoclonal antibody (M01), clone 5B8 |
Product description: | Mouse monoclonal antibody raised against a partial recombinant POU4F3. |
Clone: | 5B8 |
Isotype: | IgG1 Kappa |
Gene id: | 5459 |
Gene name: | POU4F3 |
Gene alias: | BRN3C|DFNA15|MGC138412 |
Gene description: | POU class 4 homeobox 3 |
Genbank accession: | NM_002700 |
Immunogen: | POU4F3 (NP_002691, 100 a.a. ~ 190 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. |
Immunogen sequence/protein sequence: | PAALTSHPHHAVHQGLEGDLLEHISPTLSVSGLGAPEHSVMPAQIHPHHLGAMGHLHQAMGMSHPHTVAPHSAMPACLSDVESDPRELEAF |
Protein accession: | NP_002691 |
Storage buffer: | In 1x PBS, pH 7.4 |
Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
Quality control testing: | Antibody Reactive Against Recombinant Protein. |
Quality control testing picture: | ![qc_test-H00005459-M01-1.jpg](http://www.abnova.com/qc_test_image/qc_test-H00005459-M01-1.jpg) |
Quality control testing picture note: | Western Blot detection against Immunogen (35.75 KDa) . |
Product type: | Primary antibodies |
Host species: | Mouse |
Antigen species / target species: | Human |
Reactivity: | Human |
Application image: | ![H00005459-M01-4-1-1-L.jpg](http://www.abnova.com/application_image/H00005459-M01-4-1-1-L.jpg) |
Application image note: | Immunofluorescence of monoclonal antibody to POU4F3 on HeLa cell. [antibody concentration 10 ug/ml] |
Applications: | WB-Ce,IF,S-ELISA,ELISA,WB-Re,WB-Tr,RNAi-Ab |
Shipping condition: | Dry Ice |