Brand | Abnova |
Product type | Primary antibodies |
Reactivity | Human |
Host species | Mouse |
Applications | S-ELISA,ELISA,WB-Re,WB-Tr |
Brand: | Abnova |
Reference: | H00005457-M04 |
Product name: | POU4F1 monoclonal antibody (M04), clone 7B4 |
Product description: | Mouse monoclonal antibody raised against a partial recombinant POU4F1. |
Clone: | 7B4 |
Isotype: | IgG2a Kappa |
Gene id: | 5457 |
Gene name: | POU4F1 |
Gene alias: | BRN3A|FLJ13449|Oct-T1|RDC-1 |
Gene description: | POU class 4 homeobox 1 |
Genbank accession: | NM_006237 |
Immunogen: | POU4F1 (NP_006228.2, 331 a.a. ~ 420 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. |
Immunogen sequence/protein sequence: | QAWLEEAEGAQREKMNKPELFNGGEKKRKRTSIAAPEKRSLEAYFAVQPRPSSEKIAAIAEKLDLKKNVVRVWFCNQRQKQKRMKFSATY |
Protein accession: | NP_006228.2 |
Storage buffer: | In 1x PBS, pH 7.4 |
Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
Quality control testing: | Antibody Reactive Against Recombinant Protein. |
Quality control testing picture: | ![]() |
Quality control testing picture note: | Western Blot detection against Immunogen (35.64 KDa) . |
Product type: | Primary antibodies |
Host species: | Mouse |
Antigen species / target species: | Human |
Reactivity: | Human |
Application image: | ![]() |
Application image note: | Western Blot analysis of POU4F1 expression in transfected 293T cell line by POU4F1 monoclonal antibody (M04), clone 7B4. Lane 1: POU4F1 transfected lysate(46.09 KDa). Lane 2: Non-transfected lysate. |
Applications: | S-ELISA,ELISA,WB-Re,WB-Tr |
Shipping condition: | Dry Ice |