POU4F1 monoclonal antibody (M04), clone 7B4 View larger

POU4F1 monoclonal antibody (M04), clone 7B4

New product

395,00 € tax excl.

Customer ratings and reviews

Nobody has posted a review yet
in this language

Data sheet of POU4F1 monoclonal antibody (M04), clone 7B4

BrandAbnova
Product typePrimary antibodies
ReactivityHuman
Host speciesMouse
ApplicationsS-ELISA,ELISA,WB-Re,WB-Tr

More info about POU4F1 monoclonal antibody (M04), clone 7B4

Brand: Abnova
Reference: H00005457-M04
Product name: POU4F1 monoclonal antibody (M04), clone 7B4
Product description: Mouse monoclonal antibody raised against a partial recombinant POU4F1.
Clone: 7B4
Isotype: IgG2a Kappa
Gene id: 5457
Gene name: POU4F1
Gene alias: BRN3A|FLJ13449|Oct-T1|RDC-1
Gene description: POU class 4 homeobox 1
Genbank accession: NM_006237
Immunogen: POU4F1 (NP_006228.2, 331 a.a. ~ 420 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Immunogen sequence/protein sequence: QAWLEEAEGAQREKMNKPELFNGGEKKRKRTSIAAPEKRSLEAYFAVQPRPSSEKIAAIAEKLDLKKNVVRVWFCNQRQKQKRMKFSATY
Protein accession: NP_006228.2
Storage buffer: In 1x PBS, pH 7.4
Storage instruction: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Quality control testing: Antibody Reactive Against Recombinant Protein.
Quality control testing picture: qc_test-H00005457-M04-1.jpg
Quality control testing picture note: Western Blot detection against Immunogen (35.64 KDa) .
Product type: Primary antibodies
Host species: Mouse
Antigen species / target species: Human
Reactivity: Human
Application image: H00005457-M04-13-15-1.jpg
Application image note: Western Blot analysis of POU4F1 expression in transfected 293T cell line by POU4F1 monoclonal antibody (M04), clone 7B4.

Lane 1: POU4F1 transfected lysate(46.09 KDa).
Lane 2: Non-transfected lysate.
Applications: S-ELISA,ELISA,WB-Re,WB-Tr
Shipping condition: Dry Ice

Reviews

Buy POU4F1 monoclonal antibody (M04), clone 7B4 now

Add to cart