PON1 monoclonal antibody (M01), clone 2H7 View larger

PON1 monoclonal antibody (M01), clone 2H7

H00005444-M01_100ug

New product

395,00 € tax excl.

100 ug

Customer ratings and reviews

Nobody has posted a review yet
in this language

Data sheet of PON1 monoclonal antibody (M01), clone 2H7

BrandAbnova
Product typePrimary antibodies
ReactivityHuman
Host speciesMouse
ApplicationsS-ELISA,ELISA,WB-Re

More info about PON1 monoclonal antibody (M01), clone 2H7

Brand: Abnova
Reference: H00005444-M01
Product name: PON1 monoclonal antibody (M01), clone 2H7
Product description: Mouse monoclonal antibody raised against a partial recombinant PON1.
Clone: 2H7
Isotype: IgG1 Kappa
Gene id: 5444
Gene name: PON1
Gene alias: ESA|PON
Gene description: paraoxonase 1
Genbank accession: NM_000446
Immunogen: PON1 (NP_000437, 246 a.a. ~ 355 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Immunogen sequence/protein sequence: HVYEKHANWTLTPLKSLDFNTLVDNISVDPETGDLWVGCHPNGMKIFFYDSENPPASEVLRIQNILTEEPKVTQVYAENGTVLQGSTVASVYKGKLLIGTVFHKALYCEL
Protein accession: NP_000437
Storage buffer: In 1x PBS, pH 7.4
Storage instruction: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Quality control testing: Antibody Reactive Against Recombinant Protein.
Quality control testing picture: qc_test-H00005444-M01-1.jpg
Quality control testing picture note: Western Blot detection against Immunogen (37.84 KDa) .
Product type: Primary antibodies
Host species: Mouse
Antigen species / target species: Human
Reactivity: Human
Application image: H00005444-M01-9-22-1.jpg
Application image note: Detection limit for recombinant GST tagged PON1 is approximately 0.03ng/ml as a capture antibody.
Applications: S-ELISA,ELISA,WB-Re
Shipping condition: Dry Ice
Publications: Apo L1 levels in HDL and cardiovascular event presentation in patients with familial hypercholesterolemia.Cubedo J, Padro T, Alonso R, Mata P, Badimon L.
J Lipid Res. 2016 Apr 25. [Epub ahead of print]

Reviews

Buy PON1 monoclonal antibody (M01), clone 2H7 now

Add to cart