Cart 1 Product Products 96,67 € (empty)
No products
To be determined Shipping
96,67 € Total
Prices are tax excluded
Product successfully added to your shopping cart
Quantity
Total
There are 1 items in your cart. There is 1 item in your cart.
Total products (tax excl.) 96,67 €
Total shipping (tax excl.) To be determined
Total (tax excl.) 96,67 €
View larger 
Data sheet of POLR2L purified MaxPab rabbit polyclonal antibody (D01P)
| Brand | Abnova |
| Product type | Primary antibodies |
| Reactivity | Human |
| Host species | Rabbit |
| Applications | WB-Tr |
More info about POLR2L purified MaxPab rabbit polyclonal antibody (D01P)
| Brand: | Abnova |
| Reference: | H00005441-D01P |
| Product name: | POLR2L purified MaxPab rabbit polyclonal antibody (D01P) |
| Product description: | Rabbit polyclonal antibody raised against a full-length human POLR2L protein. |
| Gene id: | 5441 |
| Gene name: | POLR2L |
| Gene alias: | RBP10|RPABC5|RPB10|RPB10beta|RPB7.6|hRPB7.6|hsRPB10b |
| Gene description: | polymerase (RNA) II (DNA directed) polypeptide L, 7.6kDa |
| Genbank accession: | NM_021128.3 |
| Immunogen: | POLR2L (NP_066951.1, 1 a.a. ~ 67 a.a) full-length human protein. |
| Immunogen sequence/protein sequence: | MIIPVRCFTCGKIVGNKWEAYLGLLQAEYTEGDALDALGLKRYCCRRMLLAHVDLIEKLLNYAPLEK |
| Protein accession: | NP_066951.1 |
| Storage buffer: | In 1x PBS, pH 7.4 |
| Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
| Quality control testing: | Antibody reactive against mammalian transfected lysate. |
| Product type: | Primary antibodies |
| Host species: | Rabbit |
| Antigen species / target species: | Human |
| Reactivity: | Human |
| Application image: |  |
| Application image note: | Western Blot analysis of POLR2L expression in transfected 293T cell line (H00005441-T04) by POLR2L MaxPab polyclonal antibody. Lane 1: POLR2L transfected lysate(7.60 KDa). Lane 2: Non-transfected lysate. |
| Applications: | WB-Tr |
| Shipping condition: | Dry Ice |