Brand | Abnova |
Product type | Primary antibodies |
Reactivity | Human |
Host species | Mouse |
Applications | S-ELISA,ELISA,WB-Re,WB-Tr |
Brand: | Abnova |
Reference: | H00005439-M02 |
Product name: | POLR2J monoclonal antibody (M02), clone 1A10 |
Product description: | Mouse monoclonal antibody raised against a full-length recombinant POLR2J. |
Clone: | 1A10 |
Isotype: | IgG1 Kappa |
Gene id: | 5439 |
Gene name: | POLR2J |
Gene alias: | MGC71910|POLR2J1|RPB11|RPB11A|RPB11m|hRPB14 |
Gene description: | polymerase (RNA) II (DNA directed) polypeptide J, 13.3kDa |
Genbank accession: | BC024165 |
Immunogen: | POLR2J (AAH24165, 1 a.a. ~ 117 a.a) full-length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. |
Immunogen sequence/protein sequence: | MNAPPAFESFLLFEGEKKITINKDTKVPNACLFTINKEDHTLGNIIKSQLLKDPQVLFAGYKVPHPLEHKIIIRVQTTPDYSPQEAFTNAITDLISELSLLEERFRVAIKDKQEGIE |
Protein accession: | AAH24165 |
Storage buffer: | In 1x PBS, pH 7.4 |
Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
Quality control testing: | Antibody Reactive Against Recombinant Protein. |
Quality control testing picture: | ![]() |
Quality control testing picture note: | Western Blot detection against Immunogen (38.61 KDa) . |
Product type: | Primary antibodies |
Host species: | Mouse |
Antigen species / target species: | Human |
Reactivity: | Human |
Application image: | ![]() |
Application image note: | Western Blot analysis of POLR2J expression in transfected 293T cell line by POLR2J monoclonal antibody (M02), clone 1A10. Lane 1: POLR2J transfected lysate(13.3 KDa). Lane 2: Non-transfected lysate. |
Applications: | S-ELISA,ELISA,WB-Re,WB-Tr |
Shipping condition: | Dry Ice |