POLR2H polyclonal antibody (A01) View larger

POLR2H polyclonal antibody (A01)

New product

286,00 € tax excl.

Customer ratings and reviews

Nobody has posted a review yet
in this language

Data sheet of POLR2H polyclonal antibody (A01)

BrandAbnova
Product typePrimary antibodies
ReactivityHuman
Host speciesMouse
ApplicationsELISA,WB-Re

More info about POLR2H polyclonal antibody (A01)

Brand: Abnova
Reference: H00005437-A01
Product name: POLR2H polyclonal antibody (A01)
Product description: Mouse polyclonal antibody raised against a full-length recombinant POLR2H.
Gene id: 5437
Gene name: POLR2H
Gene alias: RPABC3|RPB17|RPB8|hsRPB8
Gene description: polymerase (RNA) II (DNA directed) polypeptide H
Genbank accession: BC000739
Immunogen: POLR2H (AAH00739, 1 a.a. ~ 150 a.a) full-length recombinant protein with GST tag.
Immunogen sequence/protein sequence: MAGILFEDIFDVKDIDPEGKKFDRVSRLHCESESFKMDLILDVNIQIYPVDLGDKFRLVIASTLYEDGTLDDGEYNPTDDRPSRADQFEYVMYGKVYRIEGDETSTEAATRLSAYVSYGGLLMRLQGDANNLHGFEVDSRVYLLMKKLAF
Protein accession: AAH00739
Storage buffer: 50 % glycerol
Storage instruction: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Quality control testing: Antibody Reactive Against Recombinant Protein.
Quality control testing picture: qc_test-H00005437-A01-1.jpg
Quality control testing picture note: Western Blot detection against Immunogen (42.61 KDa) .
Product type: Primary antibodies
Host species: Mouse
Antigen species / target species: Human
Reactivity: Human
Applications: ELISA,WB-Re
Shipping condition: Dry Ice

Reviews

Buy POLR2H polyclonal antibody (A01) now

Add to cart