Brand | Abnova |
Product type | Primary antibodies |
Reactivity | Human |
Host species | Mouse |
Applications | ELISA,WB-Re,WB-Tr |
Brand: | Abnova |
Reference: | H00005433-M01 |
Product name: | POLR2D monoclonal antibody (M01), clone 1E4-A5 |
Product description: | Mouse monoclonal antibody raised against a full length recombinant POLR2D. |
Clone: | 1E4-A5 |
Isotype: | IgG1 kappa |
Gene id: | 5433 |
Gene name: | POLR2D |
Gene alias: | HSRBP4|HSRPB4|RBP4 |
Gene description: | polymerase (RNA) II (DNA directed) polypeptide D |
Genbank accession: | BC017205 |
Immunogen: | POLR2D (AAH17205, 1 a.a. ~ 142 a.a) full-length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. |
Immunogen sequence/protein sequence: | MAAGGSDPRAGDVEEDASQLIFPKGFETAETLLNSEVHMLLEHRKQQNESAEDEQELSEVFMKTLNYTARFSRFKNRETIASVRSLLLQKKLHKFELACLANLCPETAEESKALIPSLEGRFEDEELQQILDDIQTKRSFQY |
Protein accession: | AAH17205 |
Storage buffer: | In 1x PBS, pH 7.4 |
Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
Quality control testing: | Antibody Reactive Against Recombinant Protein. |
Quality control testing picture: | ![]() |
Quality control testing picture note: | Western Blot detection against Immunogen (41.36 KDa) . |
Product type: | Primary antibodies |
Host species: | Mouse |
Antigen species / target species: | Human |
Reactivity: | Human |
Application image: | ![]() |
Application image note: | Western Blot analysis of POLR2D expression in transfected 293T cell line by POLR2D monoclonal antibody (M01), clone 1E4-A5. Lane 1: POLR2D transfected lysate(16.3 KDa). Lane 2: Non-transfected lysate. |
Applications: | ELISA,WB-Re,WB-Tr |
Shipping condition: | Dry Ice |