POLE purified MaxPab mouse polyclonal antibody (B01P) View larger

POLE purified MaxPab mouse polyclonal antibody (B01P)

New product

395,00 € tax excl.

Customer ratings and reviews

Nobody has posted a review yet
in this language

Data sheet of POLE purified MaxPab mouse polyclonal antibody (B01P)

BrandAbnova
Product typePrimary antibodies
ReactivityHuman
Host speciesMouse
ApplicationsIF,WB-Tr

More info about POLE purified MaxPab mouse polyclonal antibody (B01P)

Brand: Abnova
Reference: H00005426-B01P
Product name: POLE purified MaxPab mouse polyclonal antibody (B01P)
Product description: Mouse polyclonal antibody raised against a full-length human POLE protein.
Gene id: 5426
Gene name: POLE
Gene alias: DKFZp434F222|FLJ21434|POLE1
Gene description: polymerase (DNA directed), epsilon
Genbank accession: BC021559
Immunogen: POLE (AAH21559, 1 a.a. ~ 370 a.a) full-length human protein.
Immunogen sequence/protein sequence: MDPSNYGGIKGKVSSRIHCGLQDSQKAGGAEDEQENEDDEEERDGEEEEEAEESNVEDLLENNWNILQFLPQAASCQNYFLMIVSAYIVAVYHCMKDGLRRSAPGSTPVRRRGASQLSQEAEGAVGALPGMITFSQDYVANELTQSFFTITQKIQKKVTGSRNSTELSEMFPVLPGSHLLLNNPALEFIKYVCKVLSLDTNITNQVNKLNRDLLRLVDVGEFSEEAQFRDPCRSYVLPEVICRSCNFCRDLDLCKDSSFSEDGAVLPQWLCSNCQAPYDSSAIEMTLVEVLQKKLVAFTLQDLVCLKCRGVKETSMPVYCSCAGDFALTIHTQVFMEQIGIFRNIAQHYGMSYLLETLEWLLQKNPQLGH
Protein accession: AAH21559
Storage buffer: In 1x PBS, pH 7.4
Storage instruction: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Quality control testing: Antibody reactive against mammalian transfected lysate.
Product type: Primary antibodies
Host species: Mouse
Antigen species / target species: Human
Reactivity: Human
Application image: H00005426-B01P-13-15-1.jpg
Application image note: Western Blot analysis of POLE expression in transfected 293T cell line (H00005426-T01) by POLE MaxPab polyclonal antibody.

Lane 1: POLE transfected lysate(40.81 KDa).
Lane 2: Non-transfected lysate.
Applications: IF,WB-Tr
Shipping condition: Dry Ice

Reviews

Buy POLE purified MaxPab mouse polyclonal antibody (B01P) now

Add to cart