Brand: | Abnova |
Reference: | H00005412-M05 |
Product name: | UBL3 monoclonal antibody (M05), clone 3A8 |
Product description: | Mouse monoclonal antibody raised against a full length recombinant UBL3. |
Clone: | 3A8 |
Isotype: | IgG1 Kappa |
Gene id: | 5412 |
Gene name: | UBL3 |
Gene alias: | DKFZp434K151|FLJ32018|HCG-1|PNSC1 |
Gene description: | ubiquitin-like 3 |
Genbank accession: | BC059385 |
Immunogen: | UBL3 (AAH59385, 1 a.a. ~ 117 a.a) full-length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. |
Immunogen sequence/protein sequence: | MSSNVPADMINLRLILVSGKTKEFLFSPNDSASDIAKHVYDNWPMDWEEEQVSSPNILRLIYQGRFLHGNVTLGALKLPFGKTTVMHLVARETLPEPNSQGQRNREKTGESNCCVIL |
Protein accession: | AAH59385 |
Storage buffer: | In 1x PBS, pH 7.4 |
Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
Quality control testing: | Antibody Reactive Against Recombinant Protein. |
Quality control testing picture: |  |
Quality control testing picture note: | Western Blot detection against Immunogen (38.61 KDa) . |
Product type: | Primary antibodies |
Host species: | Mouse |
Antigen species / target species: | Human |
Reactivity: | Human |
Application image: |  |
Application image note: | Detection limit for recombinant GST tagged UBL3 is approximately 1ng/ml as a capture antibody. |
Applications: | S-ELISA,ELISA,WB-Re,WB-Tr |
Shipping condition: | Dry Ice |