PNLIPRP2 monoclonal antibody (M03), clone 4F10 View larger

PNLIPRP2 monoclonal antibody (M03), clone 4F10

H00005408-M03_100ug

New product

395,00 € tax excl.

100 ug

Customer ratings and reviews

Nobody has posted a review yet
in this language

Data sheet of PNLIPRP2 monoclonal antibody (M03), clone 4F10

BrandAbnova
Product typePrimary antibodies
ReactivityHuman
Host speciesMouse
ApplicationsS-ELISA,ELISA

More info about PNLIPRP2 monoclonal antibody (M03), clone 4F10

Brand: Abnova
Reference: H00005408-M03
Product name: PNLIPRP2 monoclonal antibody (M03), clone 4F10
Product description: Mouse monoclonal antibody raised against a partial recombinant PNLIPRP2.
Clone: 4F10
Isotype: IgG2b Kappa
Gene id: 5408
Gene name: PNLIPRP2
Gene alias: PLRP2
Gene description: pancreatic lipase-related protein 2
Genbank accession: NM_005396
Immunogen: PNLIPRP2 (NP_005387, 333 a.a. ~ 435 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Immunogen sequence/protein sequence: FKGKTSAVEQTFFLNTGESGNFTSWRYKVSVTLSGKEKVNGYIRIALYGSNENSKQYEIFKGSLKPDASHTCAIDVDFNVGKIQKVKFLWNKRGINLSEPKLG
Protein accession: NP_005387
Storage buffer: In 1x PBS, pH 7.4
Storage instruction: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Quality control testing: Antibody Reactive Against Recombinant Protein.
Product type: Primary antibodies
Host species: Mouse
Antigen species / target species: Human
Reactivity: Human
Application image: H00005408-M03-9-20-1.jpg
Application image note: Detection limit for recombinant GST tagged PNLIPRP2 is approximately 0.3ng/ml as a capture antibody.
Applications: S-ELISA,ELISA
Shipping condition: Dry Ice

Reviews

Buy PNLIPRP2 monoclonal antibody (M03), clone 4F10 now

Add to cart