Cart 0 Product Products (empty)
No products
To be determined Shipping
0,00 € Total
Prices are tax excluded
Product successfully added to your shopping cart
Quantity
Total
There are 0 items in your cart. There is 1 item in your cart.
Total products (tax excl.)
Total shipping (tax excl.) To be determined
Total (tax excl.)
Data sheet of PRRX1 monoclonal antibody (M01), clone 1E2
| Brand | Abnova |
| Product type | Primary antibodies |
| Reactivity | Human |
| Host species | Mouse |
| Applications | S-ELISA,ELISA,WB-Re,WB-Tr |
More info about PRRX1 monoclonal antibody (M01), clone 1E2
| Brand: | Abnova |
| Reference: | H00005396-M01 |
| Product name: | PRRX1 monoclonal antibody (M01), clone 1E2 |
| Product description: | Mouse monoclonal antibody raised against a partial recombinant PRRX1. |
| Clone: | 1E2 |
| Isotype: | IgG1 Kappa |
| Gene id: | 5396 |
| Gene name: | PRRX1 |
| Gene alias: | PHOX1|PMX1|PRX1 |
| Gene description: | paired related homeobox 1 |
| Genbank accession: | NM_022716 |
| Immunogen: | PRRX1 (NP_073207, 1 a.a. ~ 90 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. |
| Immunogen sequence/protein sequence: | MTSSYGHVLERQPALGGRLDSPGNLDTLQAKKNFSVSHLLDLEEAGDMVAAQADENVGEAGRSLLESPGLTSGSDTPQQDNDQLNSEEKK |
| Protein accession: | NP_073207 |
| Storage buffer: | In 1x PBS, pH 7.4 |
| Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
| Quality control testing: | Antibody Reactive Against Recombinant Protein. |
| Quality control testing picture: |  |
| Quality control testing picture note: | Western Blot detection against Immunogen (35.64 KDa) . |
| Product type: | Primary antibodies |
| Host species: | Mouse |
| Antigen species / target species: | Human |
| Reactivity: | Human |
| Application image: |  |
| Application image note: | Western Blot analysis of PRRX1 expression in transfected 293T cell line by PRRX1 monoclonal antibody (M01), clone 1E2. Lane 1: PRRX1 transfected lysate (Predicted MW: 24.4 KDa). Lane 2: Non-transfected lysate. |
| Applications: | S-ELISA,ELISA,WB-Re,WB-Tr |
| Shipping condition: | Dry Ice |
| Publications: | Downregulation of PRRX1 Confers Cancer Stem Cell-Like Properties and Predicts Poor Prognosis in Hepatocellular Carcinoma.Hirata H, Sugimachi K, Takahashi Y, Ueda M, Sakimura S, Uchi R, Kurashige J, Takano Y, Nanbara S, Komatsu H, Saito T, Shinden Y, Iguchi T, Eguchi H, Atsumi K, Sakamoto K, Doi T, Hirakawa M, Honda H, Mimori K Ann Surg Oncol. 2014 Nov 18. |