Brand: | Abnova |
Reference: | H00005395-M02 |
Product name: | PMS2 monoclonal antibody (M02), clone 4A8 |
Product description: | Mouse monoclonal antibody raised against a partial recombinant PMS2. |
Clone: | 4A8 |
Isotype: | IgG2a Kappa |
Gene id: | 5395 |
Gene name: | PMS2 |
Gene alias: | HNPCC4|PMS2CL|PMSL2 |
Gene description: | PMS2 postmeiotic segregation increased 2 (S. cerevisiae) |
Genbank accession: | NM_000535 |
Immunogen: | PMS2 (NP_000526, 763 a.a. ~ 862 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. |
Immunogen sequence/protein sequence: | ERAKLISLPTSKNWTFGPQDVDELIFMLSDSPGVMCRPSRVKQMFASRACRKSVMIGTALNTSEMKKLITHMGEMDHPWNCPHGRPTMRHIANLGVISQN |
Protein accession: | NP_000526 |
Storage buffer: | In 1x PBS, pH 7.4 |
Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
Quality control testing: | Antibody Reactive Against Recombinant Protein. |
Product type: | Primary antibodies |
Host species: | Mouse |
Antigen species / target species: | Human |
Reactivity: | Human |
Application image: |  |
Application image note: | Detection limit for recombinant GST tagged PMS2 is 0.3 ng/ml as a capture antibody. |
Applications: | IF,S-ELISA,ELISA |
Shipping condition: | Dry Ice |