PMP22 monoclonal antibody (M10), clone 3G10 View larger

PMP22 monoclonal antibody (M10), clone 3G10

H00005376-M10_100ug

New product

395,00 € tax excl.

100 ug

Customer ratings and reviews

Nobody has posted a review yet
in this language

Data sheet of PMP22 monoclonal antibody (M10), clone 3G10

BrandAbnova
Product typePrimary antibodies
ReactivityHuman
Host speciesMouse
ApplicationsS-ELISA,ELISA

More info about PMP22 monoclonal antibody (M10), clone 3G10

Brand: Abnova
Reference: H00005376-M10
Product name: PMP22 monoclonal antibody (M10), clone 3G10
Product description: Mouse monoclonal antibody raised against a partial recombinant PMP22.
Clone: 3G10
Isotype: IgG2b Kappa
Gene id: 5376
Gene name: PMP22
Gene alias: CMT1A|CMT1E|DSS|GAS-3|HMSNIA|HNPP|MGC20769|Sp110
Gene description: peripheral myelin protein 22
Genbank accession: BC019040
Immunogen: PMP22 (AAH19040, 25 a.a. ~ 114 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Immunogen sequence/protein sequence: VSQWIVGNGHATDLWQNCSTSSSGNVHHCFSSSPNEWLQSVQATMILSIIFSILSLFLFFCQLFTLTKGGRFYITGIFQILAGLCVMSAA
Protein accession: AAH19040
Storage buffer: In 1x PBS, pH 7.4
Storage instruction: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Quality control testing: Antibody Reactive Against Recombinant Protein.
Product type: Primary antibodies
Host species: Mouse
Antigen species / target species: Human
Reactivity: Human
Application image: http://www.abnova.com/application_image/
Application image note: Detection limit for recombinant GST tagged PMP22 is approximately 30ng/ml as a capture antibody.
Applications: S-ELISA,ELISA
Shipping condition: Dry Ice

Reviews

Buy PMP22 monoclonal antibody (M10), clone 3G10 now

Add to cart