Brand: | Abnova |
Reference: | H00005373-A01 |
Product name: | PMM2 polyclonal antibody (A01) |
Product description: | Mouse polyclonal antibody raised against a partial recombinant PMM2. |
Gene id: | 5373 |
Gene name: | PMM2 |
Gene alias: | CDG1|CDG1a|CDGS |
Gene description: | phosphomannomutase 2 |
Genbank accession: | NM_000303 |
Immunogen: | PMM2 (NP_000294, 47 a.a. ~ 111 a.a) partial recombinant protein with GST tag. |
Immunogen sequence/protein sequence: | SDFEKVQEQLGNDVVEKYDYVFPENGLVAYKDGKLLCRQNIQSHLGEALIQDLINYCLSYIAKIK |
Protein accession: | NP_000294 |
Storage buffer: | 50 % glycerol |
Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
Quality control testing: | Antibody Reactive Against Recombinant Protein. |
Quality control testing picture: | ![qc_test-H00005373-A01-1.jpg](http://www.abnova.com/qc_test_image/qc_test-H00005373-A01-1.jpg) |
Quality control testing picture note: | Western Blot detection against Immunogen (33.26 KDa) . |
Product type: | Primary antibodies |
Host species: | Mouse |
Antigen species / target species: | Human |
Reactivity: | Human |
Application image: | ![H00005373-A01-1-2-1.jpg](http://www.abnova.com/application_image/H00005373-A01-1-2-1.jpg) |
Application image note: | PMM2 polyclonal antibody (A01), Lot # 051219JC01 Western Blot analysis of PMM2 expression in HL-60 ( Cat # L014V1 ). |
Applications: | WB-Ce,ELISA,WB-Re |
Shipping condition: | Dry Ice |
Publications: | Pharmacological Chaperoning: A Potential Treatment For PMM2-CDG.Yuste-Checa P, Brasil S, Gamez A, Underhaug J, Desviat LR, Ugarte M, Perez-Cerda C, Martinez A, Perez B. Hum Mutat. 2016 Oct 24. [Epub ahead of print] |