PLRG1 polyclonal antibody (A02) View larger

PLRG1 polyclonal antibody (A02)

New product

286,00 € tax excl.

Customer ratings and reviews

Nobody has posted a review yet
in this language

Data sheet of PLRG1 polyclonal antibody (A02)

BrandAbnova
Product typePrimary antibodies
ReactivityHuman
Host speciesMouse
ApplicationsELISA,WB-Re

More info about PLRG1 polyclonal antibody (A02)

Brand: Abnova
Reference: H00005356-A02
Product name: PLRG1 polyclonal antibody (A02)
Product description: Mouse polyclonal antibody raised against a partial recombinant PLRG1.
Gene id: 5356
Gene name: PLRG1
Gene alias: MGC110980|PRL1
Gene description: pleiotropic regulator 1 (PRL1 homolog, Arabidopsis)
Genbank accession: NM_002669
Immunogen: PLRG1 (NP_002660, 101 a.a. ~ 198 a.a) partial recombinant protein with GST tag.
Immunogen sequence/protein sequence: PPGPGVALTADTKIQRMPSESAAQSLAVALPLQTKADANRTAPSGSEYRHPGASDRPQPTAMNSIVMETGNTKNSALMAKKAPTMPKPQWHPPWKLYR
Protein accession: NP_002660
Storage buffer: 50 % glycerol
Storage instruction: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Quality control testing: Antibody Reactive Against Recombinant Protein.
Quality control testing picture: qc_test-H00005356-A02-1.jpg
Quality control testing picture note: Western Blot detection against Immunogen (36.89 KDa) .
Product type: Primary antibodies
Host species: Mouse
Antigen species / target species: Human
Reactivity: Human
Applications: ELISA,WB-Re
Shipping condition: Dry Ice

Reviews

Buy PLRG1 polyclonal antibody (A02) now

Add to cart