Brand: | Abnova |
Reference: | H00005355-M01 |
Product name: | PLP2 monoclonal antibody (M01), clone 2G7 |
Product description: | Mouse monoclonal antibody raised against a full-length recombinant PLP2. |
Clone: | 2G7 |
Isotype: | IgG1 Kappa |
Gene id: | 5355 |
Gene name: | PLP2 |
Gene alias: | A4|A4-LSB|MGC126187 |
Gene description: | proteolipid protein 2 (colonic epithelium-enriched) |
Genbank accession: | NM_002668.1 |
Immunogen: | PLP2 (NP_002659.1, 1 a.a. ~ 152 a.a) full-length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. |
Immunogen sequence/protein sequence: | MADSERLSAPGCWAACTNFSRTRKGILLFAEIILCLVILICFSASTPGYSSLSVIEMILAAIFFVVYMCDLHTKIPFINWPWSDFFRTLIAAILYLITSIVVLVERGNHSKIVAGVLGLIATCLFGYDAYVTFPVRQPRHTAAPTDPADGPV |
Protein accession: | NP_002659.1 |
Storage buffer: | In 1x PBS, pH 7.4 |
Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
Quality control testing: | Antibody Reactive Against Recombinant Protein. |
Quality control testing picture: |  |
Quality control testing picture note: | Western Blot detection against Immunogen (43.1 KDa) . |
Product type: | Primary antibodies |
Host species: | Mouse |
Antigen species / target species: | Human |
Reactivity: | Human |
Application image: |  |
Application image note: | Detection limit for recombinant GST tagged PLP2 is 0.03 ng/ml as a capture antibody. |
Applications: | WB-Ce,WB-Ti,S-ELISA,ELISA,WB-Re |
Shipping condition: | Dry Ice |