Cart 0 Product Products (empty)
No products
To be determined Shipping
0,00 € Total
Prices are tax excluded
Product successfully added to your shopping cart
Quantity
Total
There are 0 items in your cart. There is 1 item in your cart.
Total products (tax excl.)
Total shipping (tax excl.) To be determined
Total (tax excl.)
Data sheet of PLP1 (Human) Recombinant Protein (Q01)
| Brand | Abnova |
| Product type | Proteins |
| Host species | Wheat Germ (in vitro) |
| Applications | AP,Array,ELISA,WB-Re |
More info about PLP1 (Human) Recombinant Protein (Q01)
| Brand: | Abnova |
| Reference: | H00005354-Q01 |
| Product name: | PLP1 (Human) Recombinant Protein (Q01) |
| Product description: | Human PLP1 partial ORF ( NP_000524, 177 a.a. - 232 a.a.) recombinant protein with GST-tag at N-terminal. |
| Gene id: | 5354 |
| Gene name: | PLP1 |
| Gene alias: | HLD1|MMPL|PLP|PLP/DM20|PMD|SPG2 |
| Gene description: | proteolipid protein 1 |
| Genbank accession: | NM_000533 |
| Immunogen sequence/protein sequence: | YFNTWTTCQSIAFPSKTSASIGSLCADARMYGVLPWNAFPGKVCGSNLLSICKTAE |
| Protein accession: | NP_000524 |
| Preparation method: | in vitro wheat germ expression system |
| Storage buffer: | 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
| Storage instruction: | Store at -80°C. Aliquot to avoid repeated freezing and thawing. |
| Quality control testing: | 12.5% SDS-PAGE Stained with Coomassie Blue. |
| Quality control testing picture: |  |
| Note: | Best use within three months from the date of receipt of this protein. |
| Tag: | GST |
| Product type: | Proteins |
| Host species: | Wheat Germ (in vitro) |
| Antigen species / target species: | Human |
| Applications: | AP,Array,ELISA,WB-Re |
| Shipping condition: | Dry Ice |
| Publications: | Antigen microarrays identify unique serum autoantibody signatures in clinical and pathologic subtypes of multiple sclerosis.Quintana FJ, Farez MF, Viglietta V, Iglesias AH, Merbl Y, Izquierdo G, Lucas M, Basso AS, Khoury SJ, Lucchinetti CF, Cohen IR, Weiner HL. Proc Natl Acad Sci U S A. 2008 Dec 2;105(48):18889-94. Epub 2008 Nov 21. |