PLP1 monoclonal antibody (M05), clone 4H8 View larger

PLP1 monoclonal antibody (M05), clone 4H8

New product

395,00 € tax excl.

Customer ratings and reviews

Nobody has posted a review yet
in this language

Data sheet of PLP1 monoclonal antibody (M05), clone 4H8

BrandAbnova
Product typePrimary antibodies
ReactivityHuman
Host speciesMouse
ApplicationsS-ELISA,ELISA,WB-Re

More info about PLP1 monoclonal antibody (M05), clone 4H8

Brand: Abnova
Reference: H00005354-M05
Product name: PLP1 monoclonal antibody (M05), clone 4H8
Product description: Mouse monoclonal antibody raised against a partial recombinant PLP1.
Clone: 4H8
Isotype: IgG2a Kappa
Gene id: 5354
Gene name: PLP1
Gene alias: HLD1|MMPL|PLP|PLP/DM20|PMD|SPG2
Gene description: proteolipid protein 1
Genbank accession: NM_000533
Immunogen: PLP1 (NP_000524, 177 a.a. ~ 232 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Immunogen sequence/protein sequence: YFNTWTTCQSIAFPSKTSASIGSLCADARMYGVLPWNAFPGKVCGSNLLSICKTAE
Protein accession: NP_000524
Storage buffer: In 1x PBS, pH 7.4
Storage instruction: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Quality control testing: Antibody Reactive Against Recombinant Protein.
Quality control testing picture: qc_test-H00005354-M05-1.jpg
Quality control testing picture note: Western Blot detection against Immunogen (31.9 KDa) .
Product type: Primary antibodies
Host species: Mouse
Antigen species / target species: Human
Reactivity: Human
Application image: H00005354-M05-9-22-1.jpg
Application image note: Detection limit for recombinant GST tagged PLP1 is approximately 0.03ng/ml as a capture antibody.
Applications: S-ELISA,ELISA,WB-Re
Shipping condition: Dry Ice

Reviews

Buy PLP1 monoclonal antibody (M05), clone 4H8 now

Add to cart