PLGLB2 monoclonal antibody (M04A), clone 3E6 View larger

PLGLB2 monoclonal antibody (M04A), clone 3E6

New product

395,00 € tax excl.

Customer ratings and reviews

Nobody has posted a review yet
in this language

Data sheet of PLGLB2 monoclonal antibody (M04A), clone 3E6

BrandAbnova
Product typePrimary antibodies
ReactivityHuman
Host speciesMouse
ApplicationsELISA,WB-Re

More info about PLGLB2 monoclonal antibody (M04A), clone 3E6

Brand: Abnova
Reference: H00005342-M04A
Product name: PLGLB2 monoclonal antibody (M04A), clone 3E6
Product description: Mouse monoclonal antibody raised against a partial recombinant PLGLB2.
Clone: 3E6
Isotype: IgG1 Kappa
Gene id: 5342
Gene name: PLGLB2
Gene alias: PLGP1
Gene description: plasminogen-like B2
Genbank accession: NM_002665
Immunogen: PLGLB2 (NP_002656, 21 a.a. ~ 96 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Immunogen sequence/protein sequence: PLDDYVNTQGPSLFSVTKKQLGAGSREECAAKCEEDKEFTCRAFQYHSKEQQCVIMAENRKSSIIIRMRDAVLFEK
Protein accession: NP_002656
Storage buffer: In ascites fluid
Storage instruction: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Quality control testing: Antibody Reactive Against Recombinant Protein.
Quality control testing picture: qc_test-H00005342-M04A-1.jpg
Quality control testing picture note: Western Blot detection against Immunogen (34.1 KDa) .
Product type: Primary antibodies
Host species: Mouse
Antigen species / target species: Human
Reactivity: Human
Applications: ELISA,WB-Re
Shipping condition: Dry Ice

Reviews

Buy PLGLB2 monoclonal antibody (M04A), clone 3E6 now

Add to cart