PLEK purified MaxPab rabbit polyclonal antibody (D01P) View larger

PLEK purified MaxPab rabbit polyclonal antibody (D01P)

New product

384,00 € tax excl.

Customer ratings and reviews

Nobody has posted a review yet
in this language

Data sheet of PLEK purified MaxPab rabbit polyclonal antibody (D01P)

BrandAbnova
Product typePrimary antibodies
ReactivityHuman
Host speciesRabbit
ApplicationsWB-Tr

More info about PLEK purified MaxPab rabbit polyclonal antibody (D01P)

Brand: Abnova
Reference: H00005341-D01P
Product name: PLEK purified MaxPab rabbit polyclonal antibody (D01P)
Product description: Rabbit polyclonal antibody raised against a full-length human PLEK protein.
Gene id: 5341
Gene name: PLEK
Gene alias: FLJ27168|P47
Gene description: pleckstrin
Genbank accession: NM_002664
Immunogen: PLEK (NP_002655.1, 1 a.a. ~ 350 a.a) full-length human protein.
Immunogen sequence/protein sequence: MEPKRIREGYLVKKGSVFNTWKPMWVVLLEDGIEFYKKKSDNSPKGMIPLKGSTLTSPCQDFGKRMFVFKITTTKQQDHFFQAAFLEERDAWVRDINKAIKCIEGGQKFARKSTRRSIRLPETIDLGALYLSMKDTEKGIKELNLEKDKKIFNHCFTGNCVIDWLVSNQSVRNRQEGLMIASSLLNEGYLQPAGDMSKSAVDGTAENPFLDNPDAFYYFPDSGFFCEENSSDDDVILKEEFRGVIIKQGCLLKQGHRRKNWKVRKFILREDPAYLHYYDPAGAEDPLGAIHLRGCVVTSVESNSNGRKSEEENLFEIITADEVHYFLQAATPKERTEWIKAIQMASRTGK
Protein accession: NP_002655.1
Storage buffer: In 1x PBS, pH 7.4
Storage instruction: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Quality control testing: Antibody reactive against mammalian transfected lysate.
Product type: Primary antibodies
Host species: Rabbit
Antigen species / target species: Human
Reactivity: Human
Application image: H00005341-D01P-13-15-1.jpg
Application image note: Western Blot analysis of PLEK expression in transfected 293T cell line (H00005341-T01) by PLEK MaxPab polyclonal antibody.

Lane 1: PLEK transfected lysate(40.10 KDa).
Lane 2: Non-transfected lysate.
Applications: WB-Tr
Shipping condition: Dry Ice

Reviews

Buy PLEK purified MaxPab rabbit polyclonal antibody (D01P) now

Add to cart