PLEC1 monoclonal antibody (M02), clone 4D12 View larger

PLEC1 monoclonal antibody (M02), clone 4D12

New product

395,00 € tax excl.

Customer ratings and reviews

Nobody has posted a review yet
in this language

Data sheet of PLEC1 monoclonal antibody (M02), clone 4D12

BrandAbnova
Product typePrimary antibodies
ReactivityHuman
Host speciesMouse
ApplicationsS-ELISA,ELISA,WB-Re

More info about PLEC1 monoclonal antibody (M02), clone 4D12

Brand: Abnova
Reference: H00005339-M02
Product name: PLEC1 monoclonal antibody (M02), clone 4D12
Product description: Mouse monoclonal antibody raised against a partial recombinant PLEC1.
Clone: 4D12
Isotype: IgG2a Kappa
Gene id: 5339
Gene name: PLEC1
Gene alias: EBS1|EBSO|HD1|PCN|PLEC1b|PLTN
Gene description: plectin 1, intermediate filament binding protein 500kDa
Genbank accession: NM_000445
Immunogen: PLEC1 (NP_000436, 4384 a.a. ~ 4493 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Immunogen sequence/protein sequence: CGFEDPRTKTKMSAAQALKKGWLYYEAGQRFLEVQYLTGGLIEPDTPGRVPLDEALQRGTVDARTAQKLRDVGAYSKYLTCPKTKLKISYKDALDRSMVEEGTGLRLLEA
Protein accession: NP_000436
Storage buffer: In 1x PBS, pH 7.4
Storage instruction: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Quality control testing: Antibody Reactive Against Recombinant Protein.
Quality control testing picture: qc_test-H00005339-M02-1.jpg
Quality control testing picture note: Western Blot detection against Immunogen (37.84 KDa) .
Product type: Primary antibodies
Host species: Mouse
Antigen species / target species: Human
Reactivity: Human
Application image: H00005339-M02-9-20-1.jpg
Application image note: Detection limit for recombinant GST tagged PLEC1 is approximately 0.3ng/ml as a capture antibody.
Applications: S-ELISA,ELISA,WB-Re
Shipping condition: Dry Ice

Reviews

Buy PLEC1 monoclonal antibody (M02), clone 4D12 now

Add to cart