Cart 0 Product Products (empty)
No products
To be determined Shipping
0,00 € Total
Prices are tax excluded
Product successfully added to your shopping cart
Quantity
Total
There are 0 items in your cart. There is 1 item in your cart.
Total products (tax excl.)
Total shipping (tax excl.) To be determined
Total (tax excl.)
Data sheet of PLD2 monoclonal antibody (M01), clone 1C5
| Brand | Abnova |
| Product type | Primary antibodies |
| Reactivity | Human,Rat |
| Host species | Mouse |
| Applications | WB-Ti,S-ELISA,ELISA,WB-Re,WB-Tr |
More info about PLD2 monoclonal antibody (M01), clone 1C5
| Brand: | Abnova |
| Reference: | H00005338-M01 |
| Product name: | PLD2 monoclonal antibody (M01), clone 1C5 |
| Product description: | Mouse monoclonal antibody raised against a partial recombinant PLD2. |
| Clone: | 1C5 |
| Isotype: | IgG2a Kappa |
| Gene id: | 5338 |
| Gene name: | PLD2 |
| Gene alias: | - |
| Gene description: | phospholipase D2 |
| Genbank accession: | BC015033 |
| Immunogen: | PLD2 (AAH15033, 834 a.a. ~ 933 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. |
| Immunogen sequence/protein sequence: | LRDPICDDFFQLWQDMAESNANIYEQIFRCLPSNATRSLRTLREYVAVEPLATVSPPLARSELTQVQGHLVHFPLKFLEDESLLPPLGSKEGMIPLEVWT |
| Protein accession: | AAH15033 |
| Storage buffer: | In 1x PBS, pH 7.4 |
| Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
| Quality control testing: | Antibody Reactive Against Recombinant Protein. |
| Quality control testing picture: |  |
| Quality control testing picture note: | Western Blot detection against Immunogen (36.74 KDa) . |
| Product type: | Primary antibodies |
| Host species: | Mouse |
| Antigen species / target species: | Human |
| Reactivity: | Human,Rat |
| Application image: |  |
| Application image note: | Detection limit for recombinant GST tagged PLD2 is approximately 0.03ng/ml as a capture antibody. |
| Applications: | WB-Ti,S-ELISA,ELISA,WB-Re,WB-Tr |
| Shipping condition: | Dry Ice |
| Publications: | Mechanisms for the activity of heterocyclic cyclohexanone curcumin derivatives in estrogen receptor negative human breast cancer cell lines.Somers-Edgar TJ, Taurin S, Larsen L, Chandramouli A, Nelson MA, Rosengren RJ. Invest New Drugs. 2009 Oct 9. [Epub ahead of print] |