Brand: | Abnova |
Reference: | H00005338-M01 |
Product name: | PLD2 monoclonal antibody (M01), clone 1C5 |
Product description: | Mouse monoclonal antibody raised against a partial recombinant PLD2. |
Clone: | 1C5 |
Isotype: | IgG2a Kappa |
Gene id: | 5338 |
Gene name: | PLD2 |
Gene alias: | - |
Gene description: | phospholipase D2 |
Genbank accession: | BC015033 |
Immunogen: | PLD2 (AAH15033, 834 a.a. ~ 933 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. |
Immunogen sequence/protein sequence: | LRDPICDDFFQLWQDMAESNANIYEQIFRCLPSNATRSLRTLREYVAVEPLATVSPPLARSELTQVQGHLVHFPLKFLEDESLLPPLGSKEGMIPLEVWT |
Protein accession: | AAH15033 |
Storage buffer: | In 1x PBS, pH 7.4 |
Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
Quality control testing: | Antibody Reactive Against Recombinant Protein. |
Quality control testing picture: | ![qc_test-H00005338-M01-1.jpg](http://www.abnova.com/qc_test_image/qc_test-H00005338-M01-1.jpg) |
Quality control testing picture note: | Western Blot detection against Immunogen (36.74 KDa) . |
Product type: | Primary antibodies |
Host species: | Mouse |
Antigen species / target species: | Human |
Reactivity: | Human,Rat |
Application image: | ![H00005338-M01-9-22-1.jpg](http://www.abnova.com/application_image/H00005338-M01-9-22-1.jpg) |
Application image note: | Detection limit for recombinant GST tagged PLD2 is approximately 0.03ng/ml as a capture antibody. |
Applications: | WB-Ti,S-ELISA,ELISA,WB-Re,WB-Tr |
Shipping condition: | Dry Ice |
Publications: | Mechanisms for the activity of heterocyclic cyclohexanone curcumin derivatives in estrogen receptor negative human breast cancer cell lines.Somers-Edgar TJ, Taurin S, Larsen L, Chandramouli A, Nelson MA, Rosengren RJ. Invest New Drugs. 2009 Oct 9. [Epub ahead of print] |