Cart 0 Product Products (empty)
No products
To be determined Shipping
0,00 € Total
Prices are tax excluded
Product successfully added to your shopping cart
Quantity
Total
There are 0 items in your cart. There is 1 item in your cart.
Total products (tax excl.)
Total shipping (tax excl.) To be determined
Total (tax excl.)
Data sheet of PLD1 monoclonal antibody (M02), clone 10H2
| Brand | Abnova |
| Product type | Primary antibodies |
| Reactivity | Human |
| Host species | Mouse |
| Applications | ELISA,WB-Re |
More info about PLD1 monoclonal antibody (M02), clone 10H2
| Brand: | Abnova |
| Reference: | H00005337-M02 |
| Product name: | PLD1 monoclonal antibody (M02), clone 10H2 |
| Product description: | Mouse monoclonal antibody raised against a partial recombinant PLD1. |
| Clone: | 10H2 |
| Isotype: | IgG1 Kappa |
| Gene id: | 5337 |
| Gene name: | PLD1 |
| Gene alias: | - |
| Gene description: | phospholipase D1, phosphatidylcholine-specific |
| Genbank accession: | NM_002662 |
| Immunogen: | PLD1 (NP_002653, 965 a.a. ~ 1074 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. |
| Immunogen sequence/protein sequence: | GYLDDPSEDIQDPVSDKFFKEVWVSTAARNATIYDKVFRCLPNDEVHNLIQLRDFINKPVLAKEDPIRAEEELKKIRGFLVQFPFYFLSEESLLPSVGTKEAIVPMEVWT |
| Protein accession: | NP_002653 |
| Storage buffer: | In 1x PBS, pH 7.4 |
| Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
| Quality control testing: | Antibody Reactive Against Recombinant Protein. |
| Quality control testing picture: |  |
| Quality control testing picture note: | Western Blot detection against Immunogen (37.84 KDa) . |
| Product type: | Primary antibodies |
| Host species: | Mouse |
| Antigen species / target species: | Human |
| Reactivity: | Human |
| Applications: | ELISA,WB-Re |
| Shipping condition: | Dry Ice |
| Publications: | TNF-α- and tumor-induced skeletal muscle atrophy involves sphingolipid metabolism.De Larichaudy J, Zufferli A, Serra F, Isidori AM, Naro F, Dessalle K, Desgeorges M, Piraud M, Cheillan D, Vidal H, Lefai E, Nemoz G. Skelet Muscle. 2012 Jan 18;2(1):2. |