Cart 0 Product Products (empty)
No products
To be determined Shipping
0,00 € Total
Prices are tax excluded
Product successfully added to your shopping cart
Quantity
Total
There are 0 items in your cart. There is 1 item in your cart.
Total products (tax excl.)
Total shipping (tax excl.) To be determined
Total (tax excl.)
Data sheet of PLCG1 monoclonal antibody (M01), clone 2A2
| Brand | Abnova |
| Product type | Primary antibodies |
| Reactivity | Human |
| Host species | Mouse |
| Applications | WB-Ce,IF,S-ELISA,ELISA,WB-Re,PLA-Ce |
More info about PLCG1 monoclonal antibody (M01), clone 2A2
| Brand: | Abnova |
| Reference: | H00005335-M01 |
| Product name: | PLCG1 monoclonal antibody (M01), clone 2A2 |
| Product description: | Mouse monoclonal antibody raised against a partial recombinant PLCG1. |
| Clone: | 2A2 |
| Isotype: | IgG1 kappa |
| Gene id: | 5335 |
| Gene name: | PLCG1 |
| Gene alias: | PLC-II|PLC1|PLC148|PLCgamma1 |
| Gene description: | phospholipase C, gamma 1 |
| Genbank accession: | NM_002660 |
| Immunogen: | PLCG1 (NP_002651, 1192 a.a. ~ 1291 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. |
| Immunogen sequence/protein sequence: | LKNNYSEDLELASLLIKIDIFPAKQENGDLSPFSGTSLRERGSDASGQLFHGRAREGSFESRYQQPFEDFRISQEHLADHFDSRERRAPRRTRVNGDNRL |
| Protein accession: | NP_002651 |
| Storage buffer: | In 1x PBS, pH 7.4 |
| Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
| Quality control testing: | Antibody Reactive Against Recombinant Protein. |
| Quality control testing picture: |  |
| Quality control testing picture note: | Western Blot detection against Immunogen (36.74 KDa) . |
| Product type: | Primary antibodies |
| Host species: | Mouse |
| Antigen species / target species: | Human |
| Reactivity: | Human |
| Application image: |  |
| Application image note: | PLCG1 monoclonal antibody (M01), clone 2A2 Western Blot analysis of PLCG1 expression in Hela S3 NE ( Cat # L013V3 ). |
| Applications: | WB-Ce,IF,S-ELISA,ELISA,WB-Re,PLA-Ce |
| Shipping condition: | Dry Ice |
| Publications: | An analysis of protein-protein interactions in cross-talk pathways reveals CRKL as a novel prognostic marker in hepatocellular carcinoma.Liu CH, Chen TC, Chau GY, Jan YH, Chen CH, Hsu CN, Lin KT, Juang YL, Lu PJ, Cheng HC, Chen MH, Chang CF, Ting YS, Kao CY, Hsiao M, Huang CY. Mol Cell Proteomics. 2013 Feb 8. [Epub ahead of print] |