PLAUR monoclonal antibody (M01), clone 2F11 View larger

PLAUR monoclonal antibody (M01), clone 2F11

New product

395,00 € tax excl.

Customer ratings and reviews

Nobody has posted a review yet
in this language

Data sheet of PLAUR monoclonal antibody (M01), clone 2F11

BrandAbnova
Product typePrimary antibodies
ReactivityHuman
Host speciesMouse
ApplicationsS-ELISA,ELISA,WB-Re

More info about PLAUR monoclonal antibody (M01), clone 2F11

Brand: Abnova
Reference: H00005329-M01
Product name: PLAUR monoclonal antibody (M01), clone 2F11
Product description: Mouse monoclonal antibody raised against a partial recombinant PLAUR.
Clone: 2F11
Isotype: IgG1 Kappa
Gene id: 5329
Gene name: PLAUR
Gene alias: CD87|UPAR|URKR
Gene description: plasminogen activator, urokinase receptor
Genbank accession: NM_002659
Immunogen: PLAUR (NP_002650, 25 a.a. ~ 134 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Immunogen sequence/protein sequence: CMQCKTNGDCRVEECALGQDLCRTTIVRLWEEGEEPELVEKSCTHSEKTNRTLSYRTGLKITSLTEVVCGLDLCNQGNSGRAVTYSRSRYLECISCGSSDMSCERGRHQS
Protein accession: NP_002650
Storage buffer: In 1x PBS, pH 7.2
Storage instruction: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Quality control testing: Antibody Reactive Against Recombinant Protein.
Quality control testing picture: qc_test-H00005329-M01-1.jpg
Quality control testing picture note: Western Blot detection against Immunogen (37.84 KDa) .
Product type: Primary antibodies
Host species: Mouse
Antigen species / target species: Human
Reactivity: Human
Application image: H00005329-M01-9-20-1.jpg
Application image note: Detection limit for recombinant GST tagged PLAUR is approximately 0.3ng/ml as a capture antibody.
Applications: S-ELISA,ELISA,WB-Re
Shipping condition: Dry Ice

Reviews

Buy PLAUR monoclonal antibody (M01), clone 2F11 now

Add to cart