Brand: | Abnova |
Reference: | H00005329-M01 |
Product name: | PLAUR monoclonal antibody (M01), clone 2F11 |
Product description: | Mouse monoclonal antibody raised against a partial recombinant PLAUR. |
Clone: | 2F11 |
Isotype: | IgG1 Kappa |
Gene id: | 5329 |
Gene name: | PLAUR |
Gene alias: | CD87|UPAR|URKR |
Gene description: | plasminogen activator, urokinase receptor |
Genbank accession: | NM_002659 |
Immunogen: | PLAUR (NP_002650, 25 a.a. ~ 134 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. |
Immunogen sequence/protein sequence: | CMQCKTNGDCRVEECALGQDLCRTTIVRLWEEGEEPELVEKSCTHSEKTNRTLSYRTGLKITSLTEVVCGLDLCNQGNSGRAVTYSRSRYLECISCGSSDMSCERGRHQS |
Protein accession: | NP_002650 |
Storage buffer: | In 1x PBS, pH 7.2 |
Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
Quality control testing: | Antibody Reactive Against Recombinant Protein. |
Quality control testing picture: |  |
Quality control testing picture note: | Western Blot detection against Immunogen (37.84 KDa) . |
Product type: | Primary antibodies |
Host species: | Mouse |
Antigen species / target species: | Human |
Reactivity: | Human |
Application image: |  |
Application image note: | Detection limit for recombinant GST tagged PLAUR is approximately 0.3ng/ml as a capture antibody. |
Applications: | S-ELISA,ELISA,WB-Re |
Shipping condition: | Dry Ice |