PLAUR purified MaxPab mouse polyclonal antibody (B01P) View larger

PLAUR purified MaxPab mouse polyclonal antibody (B01P)

New product

395,00 € tax excl.

Customer ratings and reviews

Nobody has posted a review yet
in this language

Data sheet of PLAUR purified MaxPab mouse polyclonal antibody (B01P)

BrandAbnova
Product typePrimary antibodies
ReactivityHuman
Host speciesMouse
ApplicationsWB-Tr

More info about PLAUR purified MaxPab mouse polyclonal antibody (B01P)

Brand: Abnova
Reference: H00005329-B01P
Product name: PLAUR purified MaxPab mouse polyclonal antibody (B01P)
Product description: Mouse polyclonal antibody raised against a full-length human PLAUR protein.
Gene id: 5329
Gene name: PLAUR
Gene alias: CD87|UPAR|URKR
Gene description: plasminogen activator, urokinase receptor
Genbank accession: NM_002659
Immunogen: PLAUR (NP_002650.1, 1 a.a. ~ 335 a.a) full-length human protein.
Immunogen sequence/protein sequence: MGHPPLLPLLLLLHTCVPASWGLRCMQCKTNGDCRVEECALGQDLCRTTIVRLWEEGEELELVEKSCTHSEKTNRTLSYRTGLKITSLTEVVCGLDLCNQGNSGRAVTYSRSRYLECISCGSSDMSCERGRHQSLQCRSPEEQCLDVVTHWIQEGEEGRPKDDRHLRGCGYLPGCPGSNGFHNNDTFHFLKCCNTTKCNEGPILELENLPQNGRQCYSCKGNSTHGCSSEETFLIDCRGPMNQCLVATGTHEPKNQSYMVRGCATASMCQHAHLGDAFSMNHIDVSCCTKSGCNHPDLDVQYRSGAAPQPGPAHLSLTITLLMTARLWGGTLLWT
Protein accession: NP_002650.1
Storage buffer: In 1x PBS, pH 7.2
Storage instruction: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Quality control testing: Antibody reactive against mammalian transfected lysate.
Product type: Primary antibodies
Host species: Mouse
Antigen species / target species: Human
Reactivity: Human
Application image: H00005329-B01P-13-15-1.jpg
Application image note: Western Blot analysis of PLAUR expression in transfected 293T cell line (H00005329-T01) by PLAUR MaxPab polyclonal antibody.

Lane 1: PLAUR transfected lysate(36.85 KDa).
Lane 2: Non-transfected lysate.
Applications: WB-Tr
Shipping condition: Dry Ice

Reviews

Buy PLAUR purified MaxPab mouse polyclonal antibody (B01P) now

Add to cart