Brand: | Abnova |
Reference: | H00005326-A01 |
Product name: | PLAGL2 polyclonal antibody (A01) |
Product description: | Mouse polyclonal antibody raised against a partial recombinant PLAGL2. |
Gene id: | 5326 |
Gene name: | PLAGL2 |
Gene alias: | FLJ23283 |
Gene description: | pleiomorphic adenoma gene-like 2 |
Genbank accession: | NM_002657 |
Immunogen: | PLAGL2 (NP_002648, 1 a.a. ~ 100 a.a) partial recombinant protein with GST tag. |
Immunogen sequence/protein sequence: | MTTFFTSVPPWIQDAKQEEEVGWKLVPRPRGREAESQVKCQCEISGTPFSNGEKLRPHSLPQPEQRPYSCPQLHCGKAFASKYKLYRHMATHSAQKPHQC |
Protein accession: | NP_002648 |
Storage buffer: | 50 % glycerol |
Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
Quality control testing: | Antibody Reactive Against Recombinant Protein. |
Quality control testing picture: | ![qc_test-H00005326-A01-1.jpg](http://www.abnova.com/qc_test_image/qc_test-H00005326-A01-1.jpg) |
Quality control testing picture note: | Western Blot detection against Immunogen (37.11 KDa) . |
Product type: | Primary antibodies |
Host species: | Mouse |
Antigen species / target species: | Human |
Reactivity: | Human |
Application image: | ![H00005326-A01-1-21-1.jpg](http://www.abnova.com/application_image/H00005326-A01-1-21-1.jpg) |
Application image note: | PLAGL2 polyclonal antibody (A01), Lot # DFC6060608QCS1 Western Blot analysis of PLAGL2 expression in LNCaP ( Cat # L004V1 ). |
Applications: | WB-Ce,ELISA,WB-Re |
Shipping condition: | Dry Ice |