Brand: | Abnova |
Reference: | H00005325-M01A |
Product name: | PLAGL1 monoclonal antibody (M01A), clone 1E2 |
Product description: | Mouse monoclonal antibody raised against a partial recombinant PLAGL1. |
Clone: | 1E2 |
Isotype: | IgM Kappa |
Gene id: | 5325 |
Gene name: | PLAGL1 |
Gene alias: | DKFZp781P1017|LOT1|MGC126275|MGC126276|ZAC|ZAC1 |
Gene description: | pleiomorphic adenoma gene-like 1 |
Genbank accession: | NM_002656 |
Immunogen: | PLAGL1 (NP_002647.2, 221 a.a. ~ 320 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. |
Immunogen sequence/protein sequence: | QPMQPLPESLASLHPSVSPGSPPPPLPNHKYNTTSTSYSPLASLPLKADTKGFCNISLFEDLPLQEPQSPQKLNPGFDLAKGNAGKVNLPKELPADAVNL |
Protein accession: | NP_002647.2 |
Storage buffer: | In ascites fluid |
Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
Quality control testing: | Antibody Reactive Against Recombinant Protein. |
Quality control testing picture: | ![qc_test-H00005325-M01A-1.jpg](http://www.abnova.com/qc_test_image/qc_test-H00005325-M01A-1.jpg) |
Quality control testing picture note: | Western Blot detection against Immunogen (36.74 KDa) . |
Product type: | Primary antibodies |
Host species: | Mouse |
Antigen species / target species: | Human |
Reactivity: | Human |
Applications: | ELISA,WB-Re |
Shipping condition: | Dry Ice |