PLAG1 monoclonal antibody (M07), clone 1F11 View larger

PLAG1 monoclonal antibody (M07), clone 1F11

New product

395,00 € tax excl.

Customer ratings and reviews

Nobody has posted a review yet
in this language

Data sheet of PLAG1 monoclonal antibody (M07), clone 1F11

BrandAbnova
Product typePrimary antibodies
ReactivityHuman
Host speciesMouse
ApplicationsIF,S-ELISA,ELISA,WB-Re

More info about PLAG1 monoclonal antibody (M07), clone 1F11

Brand: Abnova
Reference: H00005324-M07
Product name: PLAG1 monoclonal antibody (M07), clone 1F11
Product description: Mouse monoclonal antibody raised against a partial recombinant PLAG1.
Clone: 1F11
Isotype: IgG1 Kappa
Gene id: 5324
Gene name: PLAG1
Gene alias: PSA|SGPA
Gene description: pleiomorphic adenoma gene 1
Genbank accession: NM_002655
Immunogen: PLAG1 (NP_002646, 2 a.a. ~ 99 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Immunogen sequence/protein sequence: ATVIPGDLSEVRDTQKVPSGKRKRGETKPRKNFPCQLCDKAFNSVEKLKVHSYSHTGERPYKCIQQDCTKAFVSKYKLQRHMATHSPEKTHKCNYCEK
Protein accession: NP_002646
Storage buffer: In 1x PBS, pH 7.4
Storage instruction: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Quality control testing: Antibody Reactive Against Recombinant Protein.
Quality control testing picture: qc_test-H00005324-M07-1.jpg
Quality control testing picture note: Western Blot detection against Immunogen (36.52 KDa) .
Product type: Primary antibodies
Host species: Mouse
Antigen species / target species: Human
Reactivity: Human
Application image: H00005324-M07-9-19-1.jpg
Application image note: Detection limit for recombinant GST tagged PLAG1 is approximately 1ng/ml as a capture antibody.
Applications: IF,S-ELISA,ELISA,WB-Re
Shipping condition: Dry Ice

Reviews

Buy PLAG1 monoclonal antibody (M07), clone 1F11 now

Add to cart