Brand: | Abnova |
Reference: | H00005324-M07 |
Product name: | PLAG1 monoclonal antibody (M07), clone 1F11 |
Product description: | Mouse monoclonal antibody raised against a partial recombinant PLAG1. |
Clone: | 1F11 |
Isotype: | IgG1 Kappa |
Gene id: | 5324 |
Gene name: | PLAG1 |
Gene alias: | PSA|SGPA |
Gene description: | pleiomorphic adenoma gene 1 |
Genbank accession: | NM_002655 |
Immunogen: | PLAG1 (NP_002646, 2 a.a. ~ 99 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. |
Immunogen sequence/protein sequence: | ATVIPGDLSEVRDTQKVPSGKRKRGETKPRKNFPCQLCDKAFNSVEKLKVHSYSHTGERPYKCIQQDCTKAFVSKYKLQRHMATHSPEKTHKCNYCEK |
Protein accession: | NP_002646 |
Storage buffer: | In 1x PBS, pH 7.4 |
Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
Quality control testing: | Antibody Reactive Against Recombinant Protein. |
Quality control testing picture: |  |
Quality control testing picture note: | Western Blot detection against Immunogen (36.52 KDa) . |
Product type: | Primary antibodies |
Host species: | Mouse |
Antigen species / target species: | Human |
Reactivity: | Human |
Application image: |  |
Application image note: | Detection limit for recombinant GST tagged PLAG1 is approximately 1ng/ml as a capture antibody. |
Applications: | IF,S-ELISA,ELISA,WB-Re |
Shipping condition: | Dry Ice |