Brand: | Abnova |
Reference: | H00005320-M01 |
Product name: | PLA2G2A monoclonal antibody (M01), clone 2E8 |
Product description: | Mouse monoclonal antibody raised against a full-length recombinant PLA2G2A. |
Clone: | 2E8 |
Isotype: | IgG1 Kappa |
Gene id: | 5320 |
Gene name: | PLA2G2A |
Gene alias: | MOM1|PLA2|PLA2B|PLA2L|PLA2S|PLAS1|sPLA2 |
Gene description: | phospholipase A2, group IIA (platelets, synovial fluid) |
Genbank accession: | BC005919.1 |
Immunogen: | PLA2G2A (AAH05919.1, 1 a.a. ~ 144 a.a) full-length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. |
Immunogen sequence/protein sequence: | MKTLLLLAVIMIFGLLQAHGNLVNFHRMIKLTTGKEAALSYGFYGCHCGVGGRGSPKDATDRCCVTHDCCYKRLEKRGCGTKFLSYKFSNSGSRITCAKQDSCRSQLCECDKAAATCSARNKTTYNKKYQYYSNKHCRGSTPRC |
Protein accession: | AAH05919.1 |
Storage buffer: | In 1x PBS, pH 7.4 |
Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
Quality control testing: | Antibody Reactive Against Recombinant Protein. |
Product type: | Primary antibodies |
Host species: | Mouse |
Antigen species / target species: | Human |
Reactivity: | Human |
Application image: | ![H00005320-M01-9-21-1.jpg](http://www.abnova.com/application_image/H00005320-M01-9-21-1.jpg) |
Application image note: | Detection limit for recombinant GST tagged PLA2G2A is 0.1 ng/ml as a capture antibody. |
Applications: | S-ELISA,ELISA |
Shipping condition: | Dry Ice |