PLA2G1B monoclonal antibody (M14), clone 2B7 View larger

PLA2G1B monoclonal antibody (M14), clone 2B7

New product

395,00 € tax excl.

Customer ratings and reviews

Nobody has posted a review yet
in this language

Data sheet of PLA2G1B monoclonal antibody (M14), clone 2B7

BrandAbnova
Product typePrimary antibodies
ReactivityHuman
Host speciesMouse
ApplicationsS-ELISA,ELISA,WB-Re,WB-Tr

More info about PLA2G1B monoclonal antibody (M14), clone 2B7

Brand: Abnova
Reference: H00005319-M14
Product name: PLA2G1B monoclonal antibody (M14), clone 2B7
Product description: Mouse monoclonal antibody raised against a full length recombinant PLA2G1B.
Clone: 2B7
Isotype: IgG2b Kappa
Gene id: 5319
Gene name: PLA2G1B
Gene alias: MGC119834|MGC119835|PLA2|PLA2A|PPLA2
Gene description: phospholipase A2, group IB (pancreas)
Genbank accession: BC005386
Immunogen: PLA2G1B (AAH05386, 17 a.a. ~ 70 a.a) full-length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Immunogen sequence/protein sequence: SGISPRAVWQFRKMIKCVIPGSDPFLEYNNYGCYCGLGGSGTPVDELDKQKQRV
Protein accession: AAH05386
Storage buffer: In 1x PBS, pH 7.4
Storage instruction: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Quality control testing: Antibody Reactive Against Recombinant Protein.
Quality control testing picture: qc_test-H00005319-M14-1.jpg
Quality control testing picture note: Western Blot detection against Immunogen (31.68 KDa) .
Product type: Primary antibodies
Host species: Mouse
Antigen species / target species: Human
Reactivity: Human
Application image: http://www.abnova.com/application_image/
Application image note: Detection limit for recombinant GST tagged PLA2G1B is approximately 3ng/ml as a capture antibody.
Applications: S-ELISA,ELISA,WB-Re,WB-Tr
Shipping condition: Dry Ice

Reviews

Buy PLA2G1B monoclonal antibody (M14), clone 2B7 now

Add to cart