No products
Prices are tax excluded
Brand | Abnova |
Product type | Primary antibodies |
Reactivity | Human |
Host species | Rabbit |
Applications | WB-Tr |
Brand: | Abnova |
Reference: | H00005319-D01P |
Product name: | PLA2G1B purified MaxPab rabbit polyclonal antibody (D01P) |
Product description: | Rabbit polyclonal antibody raised against a full-length human PLA2G1B protein. |
Gene id: | 5319 |
Gene name: | PLA2G1B |
Gene alias: | MGC119834|MGC119835|PLA2|PLA2A|PPLA2 |
Gene description: | phospholipase A2, group IB (pancreas) |
Genbank accession: | NM_000928.2 |
Immunogen: | PLA2G1B (NP_000919.1, 1 a.a. ~ 148 a.a) full-length human protein. |
Immunogen sequence/protein sequence: | MKLLVLAVLLTVAAADSGISPRAVWQFRKMIKCVIPGSDPFLEYNNYGCYCGLGGSGTPVDELDKCCQTHDNCYDQAKKLDSCKFLLDNPYTHTYSYSCSGSAITCSSKNKECEAFICNCDRNAAICFSKAPYNKAHKNLDTKKYCQS |
Protein accession: | NP_000919.1 |
Storage buffer: | In 1x PBS, pH 7.4 |
Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
Quality control testing: | Antibody reactive against mammalian transfected lysate. |
Product type: | Primary antibodies |
Host species: | Rabbit |
Antigen species / target species: | Human |
Reactivity: | Human |
Application image: | ![]() |
Application image note: | Western Blot analysis of PLA2G1B expression in transfected 293T cell line (H00005319-T01) by PLA2G1B MaxPab polyclonal antibody. Lane 1: PLA2G1B transfected lysate(16.40 KDa). Lane 2: Non-transfected lysate. |
Applications: | WB-Tr |
Shipping condition: | Dry Ice |