Brand: | Abnova |
Reference: | H00005317-A01 |
Product name: | PKP1 polyclonal antibody (A01) |
Product description: | Mouse polyclonal antibody raised against a partial recombinant PKP1. |
Gene id: | 5317 |
Gene name: | PKP1 |
Gene alias: | B6P|MGC138829 |
Gene description: | plakophilin 1 (ectodermal dysplasia/skin fragility syndrome) |
Genbank accession: | NM_000299 |
Immunogen: | PKP1 (NP_000290, 61 a.a. ~ 159 a.a) partial recombinant protein with GST tag. |
Immunogen sequence/protein sequence: | TLSHSNRGSMYDGLADNYNYGTTSRSSYYSKFQAGNGSWGYPIYNGTLKREPDNRRFSSYSQMENWSRHYPRGSCNTTGAGSDICFMQKIKASRSEPDL |
Protein accession: | NP_000290 |
Storage buffer: | 50 % glycerol |
Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
Quality control testing: | Antibody Reactive Against Recombinant Protein. |
Quality control testing picture: | ![qc_test-H00005317-A01-1.jpg](http://www.abnova.com/qc_test_image/qc_test-H00005317-A01-1.jpg) |
Quality control testing picture note: | Western Blot detection against Immunogen (37 KDa) . |
Product type: | Primary antibodies |
Host species: | Mouse |
Antigen species / target species: | Human |
Reactivity: | Human |
Application image: | ![H00005317-A01-1-2-1.jpg](http://www.abnova.com/application_image/H00005317-A01-1-2-1.jpg) |
Application image note: | PKP1 polyclonal antibody (A01), Lot # 051012JCO1 Western Blot analysis of PKP1 expression in HL-60 ( Cat # L014V1 ). |
Applications: | WB-Ce,ELISA,WB-Re |
Shipping condition: | Dry Ice |