Brand: | Abnova |
Reference: | H00005316-M03 |
Product name: | PKNOX1 monoclonal antibody (M03), clone 4H4 |
Product description: | Mouse monoclonal antibody raised against a partial recombinant PKNOX1. |
Clone: | 4H4 |
Isotype: | IgG2a Kappa |
Gene id: | 5316 |
Gene name: | PKNOX1 |
Gene alias: | PREP1|pkonx1c |
Gene description: | PBX/knotted 1 homeobox 1 |
Genbank accession: | NM_004571 |
Immunogen: | PKNOX1 (NP_004562, 2 a.a. ~ 100 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. |
Immunogen sequence/protein sequence: | MATQTLSIDSYQDGQQMQVVTELKTEQDPNCSEPDAEGVSPPPVESQTPMDVDKQAIYRHPLFPLLALLFEKCEQSTQGSEGTTSASFDVDIENFVRKQ |
Protein accession: | NP_004562 |
Storage buffer: | In 1x PBS, pH 7.4 |
Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
Quality control testing: | Antibody Reactive Against Recombinant Protein. |
Quality control testing picture: | |
Quality control testing picture note: | Western Blot detection against Immunogen (36.63 KDa) . |
Product type: | Primary antibodies |
Host species: | Mouse |
Antigen species / target species: | Human |
Reactivity: | Human |
Application image: | |
Application image note: | PKNOX1 monoclonal antibody (M03), clone 4H4 Western Blot analysis of PKNOX1 expression in IMR-32 ( Cat # L008V1 ). |
Applications: | WB-Ce,ELISA,WB-Re |
Shipping condition: | Dry Ice |